Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR56B2C Olfactory Receptor

Gene Symbol OR56B2C
Organism Cow
Family 56
Subfamily B
Pseudo No
Location chr15:48,048,800-48,049,700 (-)

Sequence information


Nucleotide sequence

ATGTTCCAGGATCTCGGAAATTTCAACAGCTCAAAGTTTCAGGTCTCTGAGTTCATTCTT
TTGGGATTCCCAGGCATTCACAGCTGGCAGCACTGGCTATCCCTGCCCCTGGTTCTGCTC
TACCTCTTAGCTCTCAGTGCAAACATCCTTATCTTGATCATCATCAATCAAGAGGCAACA
CTGCACCAGCCTATGTATTATTTCCTGGGCATCCTGGCTGTGGTTGACATGGGCCTTGCT
ACCACCATCATGCCCAAGATTTTGACCATCTTGTGGTTCAATGCGAAGACCATTGGTCTC
CCTGAGTGCTTTGTACAGATGTATGCCATACATAGCTTTGTAGGAATGGAATCAGGCATT
TTTGTCTGCATGGCTATAGATAGATATGTGGCAATTTGTCAACCACTGTGTTATTCATCA
ATCATCACCAAATCTTTTGTGCTCAAAGCTACTGTGCTCATGGCACTCAGAAACAGCCTG
ACTACCATCCCAATTCCTGTGTTGGCGGCTCAGAGACACTATTGCTCAAAAAACCAAATT
GAGCACTGTCTGTGCTCTAATCTTGGTGTCACTAGTCTATCCTGTGATGACAGAACAGTC
AACAGTGTTTACCAGCTACTTTTGGCCTGGATACTCATGGGGAGTGACTTGGGTTTGATT
CTTGTATCCTATGCTTTGATACTTCACTCTGTACTGAAACTGAACTCAATGGAAGCTACA
TCCAAGGCCCTGAGTACCTGCACTTCCCACCTCATCCTAATCCTGTTTTTCTACACAGTC
GTTATTGTCATTTCTATCACCCATAGTGCAACAATGATGTTTCCCCTCATCCCAGTTCTA
CTCAATGTACTCCACAACGTCATTCCTCCTGCCCTCAATCCTATGGTCTATGCACTCAAG
AACAAGGAGCTCAGACAGGGCTTATGCAAGCTCCTTAAGCTGGACTTCAAAGGCAAT


Conceptual translation

MFQDLGNFNSSKFQVSEFILLGFPGIHSWQHWLSLPLVLLYLLALSANILILIIINQEAT
LHQPMYYFLGILAVVDMGLATTIMPKILTILWFNAKTIGLPECFVQMYAIHSFVGMESGI
FVCMAIDRYVAICQPLCYSSIITKSFVLKATVLMALRNSLTTIPIPVLAAQRHYCSKNQI
EHCLCSNLGVTSLSCDDRTVNSVYQLLLAWILMGSDLGLILVSYALILHSVLKLNSMEAT
SKALSTCTSHLILILFFYTVVIVISITHSATMMFPLIPVLLNVLHNVIPPALNPMVYALK
NKELRQGLCKLLKLDFKGN