Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5AN1 Olfactory Receptor

Gene Symbol OR5AN1
Organism Cow
Family 5
Subfamily AN
Pseudo No
Location chr15:83931875-83932810 (-)
Aliases LOC100299686, ENSBTAG00000037538

Sequence information


Nucleotide sequence

ATGATTAGGAGAGAAAATATCACAGAGATCACTCATTTTATCCTGTTGGGATTCTCAGAT
TTTCCCAGAATCATAGTAGTGCTCTTTGTCGTATTCCTGTTGATATACATTTTGACCATG
ACTTGGAACCTGTCGCTCCTCATCTTAATAAGAATGGACTCCCACCTTCACACCCCCATG
TATTTCTTTCTCAGTAACCTGTCCTTCATGGACATCTGCTACGTGACCTCCACAGCCCCC
AAGATGCTCTACGACTTCTTCCAGGAGCGGCAAACTATCACCTTTGTGGCTTGTGCTGTT
CAGTACTTTGTATTCTCCACCATGGGGTTGAGTGAGTCTTGCCTCATGACCGCCATGGCT
TATGACCGATATGCTGCCATTTGTAACCCACTCCTCTATTCATCAGTCATGTCGCCTGCT
CTCTGTGGTCGGATGGTGCTGGGATCCTACTTGGCTGGACTCTCTGCTTCTATATCCCAA
TTGTGTGCTATGTTCCAGCTCCACTTCTGTGGGCCTAATGTCATCAACCACTTCTTCTGT
GACCTGCCCCAGCTGTTACTTCTATCCTGCACTGACACTTTCTTTGTACAACTCTTGACT
GCCATATTAACAATGATCTTTGGGATAATAAATGCCTTAGTTATCATGATATCCTATGTC
TACATTGTAATCTCCATCATGAAGGTCACGACAGCAAGTGGCAGGTCCAAGGCTTTCAAC
ACCTGTGCTTCCCACCTGACAGCAGTCACTCTCTTCTATACCTCAAGTATCTTTGTCTAT
TTAAGTTCCAGCTCTGGTGGTTCCTCCAGCTTTGACAGATTTGCATCAGTCTTCTATACG
GTGGTGATTCCTATGTTGAATCCTTTGATTTACAGTCTGAGGAACAAAGAAATCAAAGAT
GCCTTGAAGAGGTTGCAAAAGAAGAGACGGTGTTGC


Conceptual translation

MIRRENITEITHFILLGFSDFPRIIVVLFVVFLLIYILTMTWNLSLLILIRMDSHLHTPM
YFFLSNLSFMDICYVTSTAPKMLYDFFQERQTITFVACAVQYFVFSTMGLSESCLMTAMA
YDRYAAICNPLLYSSVMSPALCGRMVLGSYLAGLSASISQLCAMFQLHFCGPNVINHFFC
DLPQLLLLSCTDTFFVQLLTAILTMIFGIINALVIMISYVYIVISIMKVTTASGRSKAFN
TCASHLTAVTLFYTSSIFVYLSSSSGGSSSFDRFASVFYTVVIPMLNPLIYSLRNKEIKD
ALKRLQKKRRCC