Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5AR1 Olfactory Receptor

Gene Symbol OR5AR1
Organism Cow
Family 5
Subfamily AR
Pseudo No
Location chr15:81,133,300-81,134,200 (+)

Sequence information


Nucleotide sequence

ATGGATAAAGAAAACCACTCAATGGTGACTGAGTTTATCTTTATGGGCATCACTCAAGAC
CCTCAGCTGCAGATCATCTTTTTTGTCATCTTCCTCTTGGTCTACCTGGTCAATGTAGTG
GGGAATGCTGGGATGATTATCCTGATCATAACAGACACTCAGCTTCACACACCCATGTAT
TTTTTCCTCTGCAACCTCTCTTTTGTCGACCTGGGCTACTCCTCAGCCATTGCCCCCAGG
ATGCTGGCTGACTTCCTAACAAAGCACAAAGTCATCTCTTTCTCCAGCTGTGCCACCCAG
TTTGCGTTCTTCGTAGGCTTTGTGGATGCTGAGTGCTATGTCCTCGCTGCCATGGCCTAC
GACCGCTTTGTGGCCATCTGTCGACCCCTCCACTACAGCGCTCTCATGTCCAAGCGAGTC
TGCTTGGCTCTCATGCTGGGCTCCTACCTGGCTGGCTTGGTGAGTTTAGTCGCCCACACT
GCCCTCACTTTCAGTCTGAGTTACTGTGGTTCCAACATCCTCAACCACTTCTTCTGTGAA
ATCCCACCACTCTTAGCCCTCTCTTGCTCAGACACCTACATCAGCGAGATCTTGCTCTTC
AGTCTCTGTGGCTTCATTGAATTCAGCACcatcctcatcatctttatctcctatgccttc
atcctcatcGCAATCATCAGAATGCGCTCAGCTGAAGGCCGCCTTAAGGCTTTCTCCACC
TGCGGGTCTCACCTCACTGGTGTCACACTTTTTTATGGTACAGTCATGTTTATGTACCTG
AGGCCAACATCCAGCTACTCCCTGGATCAAGACAAATGGGCCTCCGTGTTCTACACTGTT
ATCATCCCCATGTTGAATCCCTTGATCTACAGTTTACGGAACAAGGATGTGAAGGCTGCT
CTCAAGAAAATAATTGGAAAGAAACCTCAA


Conceptual translation

MDKENHSMVTEFIFMGITQDPQLQIIFFVIFLLVYLVNVVGNAGMIILIITDTQLHTPMY
FFLCNLSFVDLGYSSAIAPRMLADFLTKHKVISFSSCATQFAFFVGFVDAECYVLAAMAY
DRFVAICRPLHYSALMSKRVCLALMLGSYLAGLVSLVAHTALTFSLSYCGSNILNHFFCE
IPPLLALSCSDTYISEILLFSLCGFIEFSTILIIFISYAFILIAIIRMRSAEGRLKAFST
CGSHLTGVTLFYGTVMFMYLRPTSSYSLDQDKWASVFYTVIIPMLNPLIYSLRNKDVKAA
LKKIIGKKPQ