Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5H13 Olfactory Receptor

Gene Symbol OR5H13
Organism Cow
Family 5
Subfamily H
Pseudo No
Location chr1:42,203,200-42,204,100 (+)

Sequence information


Nucleotide sequence

ATGGTAAAGGAAAATGCAACATTGCTGAGAGAATTTATTCTCACAGGATTCATATATCAA
CCAGAATGGCAAATTCCCCTGTTCTTGCTGTTTTTGATGATATATCTTATCACCATCGTG
GGAAATCTTGGTCTGATTGCTCTCATCTGCAGTGATCCTCACCTTCACATTCCCATGTAC
TTATTCCTTGGGAACCTGGCTTTTGTGGATGCCTGGATATCATCCACAGTGACGCCCCAG
TTGCTGGTCAATTTCTTTGCAAAGAGCAAAATGATGTCTCTCACTGAATGCAAGATACAA
TTTTTTTCCTTTGCAGTCAGTGTAACCACAGAATGTTTTCTGCTGGCAACAATGGCATAT
GATCGCTATGTGGCCATATGCAAACCATTACTTTACCCAGTTATTATGACCAAAAGATTA
TGCATCCGGCTATTAATTTCATCATTTTTAGGTGGCCTTTTTCATGCCATACTTCATAAT
GCTTTTTTATTGAGATTGACCTTCTGTAATTCTAACATAATACATCACTTTTACTGTGAC
ATTGTACCATTATTTAAGATTTCCTGTACTGATCCTTCCATTAATTTTCTGATGGTATTT
ATTTTCTCTGGGTCAATACAGGTGTTCACTATTCTTACTGTTCTTTTCTCTTATACACTT
ATTCTTCATACAGTCTTAAAAAAGAAGTCTGTACAAGGCATAAGGAAGGCCTTCTCTACC
TGTGGAGCCCATCTCCTCTCTGTCTCTTTATACTATAGGCCTCTTCTCTTTATGTATGTT
CGCCCTGGATCTACACAAGCAGATGATCAAGATATGATGGACTCTCTGTTTTATATGGTC
ATAATCCCTCTGTTAAATCCAATCATCTACAGTTTGAGAAATAAGAAAGTCATAGATTCA
CTGTCAAAAATGTTAAAGAGAAATGCT


Conceptual translation

MVKENATLLREFILTGFIYQPEWQIPLFLLFLMIYLITIVGNLGLIALICSDPHLHIPMY
LFLGNLAFVDAWISSTVTPQLLVNFFAKSKMMSLTECKIQFFSFAVSVTTECFLLATMAY
DRYVAICKPLLYPVIMTKRLCIRLLISSFLGGLFHAILHNAFLLRLTFCNSNIIHHFYCD
IVPLFKISCTDPSINFLMVFIFSGSIQVFTILTVLFSYTLILHTVLKKKSVQGIRKAFST
CGAHLLSVSLYYRPLLFMYVRPGSTQADDQDMMDSLFYMVIIPLLNPIIYSLRNKKVIDS
LSKMLKRNA