Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5I1 Olfactory Receptor

Gene Symbol OR5I1
Organism Cow
Family 5
Subfamily I
Pseudo No
Location chr15:79774523-79775464 (-)
Aliases OR5I1, ENSBTAG00000007944

Sequence information


Nucleotide sequence

ATGGACTTTTTAGATGGAAACTGTACCTTGGTGACTGAGTTTATTCTGTTAGGGTTTCCA
ACTCGCCCTGAACTGCAGATTGTCCTGTTTCTCCTGTTTCTGACTTTGTACTCTCTGATT
TTAATGGGGAACATCGGGTTGATGATGTTAATCAGAGTTGATCTGCACCTTCAAACCCCC
ATGTATTTTTTCCTTAGTAACCTATCCTTTGTAGACCTTTGCTATTCTTCAGTCATCGTT
CCCAAAATGCTTGTCAACTTCCTCTCTCAGAACAAGTCCATTTCCTATTACGGCTGTGCC
CTGCAGTTCTATTTCTTCTGTACTTTTGCAGATACTGAATCCTTTATCTTGGCTGCCATG
GCATATGACCGCTATGTCGCCATCTGTAACCCTTTACTGTACACAGCTGTGATGTCTCGG
GGCATCTGCATATGGTTGATCGTCTTGTCATACTTTGGAGGCAATATGAGTTCCCTGGTG
CACACATCCTTTGCATTTATTCTGAAATACTGTGATAAAAATGTCATTAATCATTTTTTC
TGTGACCTCCCTCCCTTGCTTAAGTTATCGTGCACAGACACATCACTTAATGAGTGGCTT
CTCTCCACATACGGCAGCTCAGTGGAAATTATCTGCTTCATTGTCATCATCATCTCCTAC
TTTTACATTCTCCTCTCAGTCTTAAAGATCCGTTCTTCCAGTGGGAGGAAGAAGACCTTC
TCTACATGTGTTTCTCACCTGACATCCGTGGCCATCTACCAGGGAACTCTGCTCTTCGTT
TACTCACGACCCAGCTACCTGTATTCTCCCAACACTGATAAAATCATCTCAGTGTTCTAC
ACCATCATCATTCCAGTGCTGAATCCCTTGATTTATAGTTTGAGAAACAAAGACGTAAAA
GACGCTGCTAAAAAAGTCTTAAAACCAAAGATAAATTCCTCC


Conceptual translation

MDFLDGNCTLVTEFILLGFPTRPELQIVLFLLFLTLYSLILMGNIGLMMLIRVDLHLQTP
MYFFLSNLSFVDLCYSSVIVPKMLVNFLSQNKSISYYGCALQFYFFCTFADTESFILAAM
AYDRYVAICNPLLYTAVMSRGICIWLIVLSYFGGNMSSLVHTSFAFILKYCDKNVINHFF
CDLPPLLKLSCTDTSLNEWLLSTYGSSVEIICFIVIIISYFYILLSVLKIRSSSGRKKTF
STCVSHLTSVAIYQGTLLFVYSRPSYLYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDVK
DAAKKVLKPKINSS