Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5I1EP Olfactory Receptor

Gene Symbol OR5I1EP
Organism Cow
Family 5
Subfamily I
Pseudo Yes
Location chr17:59,295-60,218 (-)

Sequence information


Nucleotide sequence

ATTTTAAGACTTTTTTAGCAGCGTCTTTTATGTCTTTGTTTCTCAAACTATAAATCAAGG
GATTCAGCACTGGGATGATGATGGTGTAGAACACTGAGATGATTTTATCAGTGTTGGGAG
AATACACGTAGCTGGGTCATGAGTAAATGAAGAGCAAAGTTCCCTGGTAGATGGCCAAGG
ATGTCAGGTGAGAAGCACACATAGAGAAGGTCTTCTCCCTCCCGCTGGAAGAAAGGATCT
TTAAGACTGAGAGGAGAATGTAAAAGTAGGAGATTATGATGATGATGAAGCAGATAATTT
TCACTGAGCTGCCATATGTGGAGAGAAGCCACTCATTAAGTGACGTGTCTGTGCACAATA
ACTTAGGCAAGAGAGGGAGGTCACAGAAAAAACGATTAATGACATTTCTATCACAGTATT
TCAGAATAAACGCAAAGGATGTGTGCACCAGGGAACTCATATTGCCTCCAGAGTATGACA
AGATGATCAACCACATGCAGATGCCCTGAGACATCACAGCCGTGTACAGTAAAGGGTTAC
AGATGGCGACATAGCGGTCGCCAAGACATGGCAGCCAAGATAAAGGATTCGGTATCTGCA
AAAGTACAGAAGAAATAGAACTGCAGGGCACAGCTGTGATAGGAAATTGACTTGTTCTGA
GAGGAAGTTGACAAGCATTTTGGAAATGATGACTGAAGAATAACAAAGGTCTACAAAGGA
TAGGTTACTAAGGAAGAAATACATGGGGGTTTGAAGGTGCAGATCAACCCTGATTAACAT
CATCAATCCAATGTTCCCCATTAAAATCATAGAGTACAAAGTCAGAAACAGGAGAAACAA
GACAATCTGCAGTTCAGGGAGAGTTGAAAACCCTAACAGAATAAACTCAGTCACCAAGGT
ATAGTTTCCATCTAAAAAGTCCAT


Conceptual translation

MDFLDGNYTLVTEFILLGFSTLPELQIVLFLLFLTLYSMILMGNIGLMMLIRVDLHLQTP
MYFFLSNLSFVDLCYSSVIISKMLVNFLS\KSISYHSCALQFYFFCTFADTESFILAAM
SW\RYVAICNPLLYTAVMSQGICMWLIILSYSGGNMSSLVHTSFAFILKYCDRNVINRF
FCDLPLLPKLLCTDTSLNEWLLSTYGSSVKIICFIIIIISYFYILLSVLKILSSSGREKT
FSMCASHLTSLAIYQGTLLFIYS*PSYVYSPNTDKIISVFYTIIIPVLNPLIYSLRNKDI
KDAAKKVLK