Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5I1GP Olfactory Receptor

Gene Symbol OR5I1GP
Organism Cow
Family 5
Subfamily I
Pseudo Yes
Location chr7:204,602-205,141 (-)

Sequence information


Nucleotide sequence

CCTTTACTGTACACGGTTGTGATGTCTTGGGGCATCTGCATATGGTTGATCGTCTTGTCA
TACTTTGGAGGCAATATGAGTTCCCTGGTGCACACATCCTTTGCGTTTACTCTGAAATAC
TCTGATAAAAATGTCATTAATCATTTTTTCTGTGACCTTAAGTTATTGTGCACAGACACG
TCACTTAATGAGTGGCTTCTCTCCCCATAGGGCAGCTCAGTGGAAATTATCTTCTTCATC
GTTTTCATCATCTCCTACTTTAACAGTCTGCTCTCAGTCTTAAAGATCCATTCTTCCAGC
AGGAGGAAGAAGACCTTCTCTACCTGTGCTTCTCACCTGACATCCGTGGCCACCTACCAG
GGAACTCTGCTCTTCATTTACTCACGACCCAGCTACCTGTATTCTCCAAACACTAATAAA
ATCATCTCAGTGTTCTACACCATCATCATCCCAATGCTGAATCCTTTGATTTATAGTTTG
AGAAACAAAGATGTAAAAGACGCTGCTAAAAATGTCTTAAAACCAAAGATAAATCCCTCC


Conceptual translation

DF*DGNYTLVTEFILLGFPTCPELHIVQYLLFLTLYSMILMGNVGLMMLIRVDLHLQMPM
HFFLSNLSFVDLCYSSVIIPKILVNFLSQNKSISYHSCAL*FYFFCTFADTESFILAAMA
CDRYVAI/PLLYTVVMSWGICIWLIVLSYFGGNMSSLVHTSFAFTLKYSDKNVINHFFC
DLKLLCTDTSLNEWLLSP*GSSVEIIFFIVFIISYFNSLLSVLKIHSSSRRKKTFSTCAS
HLTSVATYQGTLLFIYSRPSYLYSPNTNKIISVFYTIIIPMLNPLIYSLRNKDVKDAAKN
VLKPKINPS