Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5R1 Olfactory Receptor

Gene Symbol OR5R1
Organism Cow
Family 5
Subfamily R
Pseudo No
Location chr15:80,990,800-80,991,800 (-)

Sequence information


Nucleotide sequence

ATGGCTAAAGTGAATCTTACTTTTGTCACTGAATTCATTCTCAAGGGAATTACAGAACGG
CCAGAGCTTCAGGTCCCCTGCTTTGTGGTGTTCTTGGTCATTTATCTGGTCACGGTGCTG
GGCAACCTGGGCTTGATTACCTTGATCAGAACTGATGCTCGACTGCACACGCCTATGTAC
TATTTCCTCAGTCACTTGGCCTTTGTTGATCTTTGCTACTCTTCTGCTATCACACCAAAG
ATGATGGTGAACTTTGTTGTGGAGCACAATACTATTGCTTTCTATGCTTGTGCGATGCAA
CTGGGCTGTTTTCTCACCTTCATGATCACGGAGTGTTTCCTCTTAGCTTCCATGGCCTAT
GATCGCTATGTAGCCATCTGTAGTCCCCTGCATTATTCCACACTGATGTCAAAGAGAGTC
TGCATTCGACTAGTGGCAGTTCCATATGTATACAGCTTTCTGGTTGCCCTGTTCCATACC
ATCATCACCTTCCGTCTAACCTACTGTGGCCCCAATGTCATTAACCATTTCTACTGTGAT
GACCTTCCTCTCTTGGCTCTGTCATGCTCAGACACACGCATGAAGGAAATTCTGATCTTT
GCCTTTGCTGGTTTTGATATGATCTGTTCGTCTTCCATTGTCCTCACGTCCTACCTCTTC
ATCATCACCACCATCCTAAGGATCTGCTCTACCCAGGGGCGACTCAAGGCCATTTCTACC
TGTGGCTCCCACATGGTGGCTGTTACTATTTTTTATGGCACGCTGATCTTTATGTACCTG
CAACCCAAGTCAAACCACTCCCTGGACACAGACAAAATGGCATCTGTGTTTTACACTGTG
GTGATCCCCATGTTGAACCCACTCATCTATAGTCTAAGAAACAAAGAGGTGAAAAGTGCC
TCCAAGAAAGTCTTGGGAAAAGGTTGTGAAACTTTAAAGatattaaaattaagaaaa


Conceptual translation

MAKVNLTFVTEFILKGITERPELQVPCFVVFLVIYLVTVLGNLGLITLIRTDARLHTPMY
YFLSHLAFVDLCYSSAITPKMMVNFVVEHNTIAFYACAMQLGCFLTFMITECFLLASMAY
DRYVAICSPLHYSTLMSKRVCIRLVAVPYVYSFLVALFHTIITFRLTYCGPNVINHFYCD
DLPLLALSCSDTRMKEILIFAFAGFDMICSSSIVLTSYLFIITTILRICSTQGRLKAIST
CGSHMVAVTIFYGTLIFMYLQPKSNHSLDTDKMASVFYTVVIPMLNPLIYSLRNKEVKSA
SKKVLGKGCETLKILKLRK