Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5W2C Olfactory Receptor

Gene Symbol OR5W2C
Organism Cow
Family 5
Subfamily W
Pseudo No
Location chr15:79720480-79721355 (-)
Aliases LOC789293

Sequence information


Nucleotide sequence

ATGGAAAGAGAGAATTGCTCCTCCTTGACTGAATTCTTTTTCTTGGGTATTACTGATAAC
ACTGAGAACAAAGTGATCCTATTTACAATGTTTCTACCTGTTTATCTCATTAATCTTCTG
GCAAATCTCGGAATGATCAGCCTGATTAGGATGGATCCCCAGCTGCACACACCCATGTAC
TTTTTCCTCAGCCACCTCTCCTTCTGTGACCTCTGCTATTCCACAGCCATCGGCCCTAAG
ATGCTGGTAGACCTATTTGCCAAGAACAAGTCAATCTCTTTCTGTGGCTGTGCTCTGCAA
TTCTTGGTCTTCTGTACCTTTGTAGATTCTGAGTGTCTCCTGCTGGCAGTGATGGCCTAT
GACCAGTACAAGGCCATCAGCAGCCCCTTGCTCTATGCAGTCAGCATGTCCAGTGGGGTG
TGCTCCCTGCTCGTGGCTGGGGTTTACCTGGTGGGAATGATAGATGGTTTGATAAACACG
ACATTAGCATTCCGTTTATGCTTCTGTGGGTCAAATGAGATTAACCACTTTTTTTGTGAT
GTTCCTCCTCTCCTGTTGATATCTTGCTCAGACACACAGCTCAATGAGTTAGTGATATTC
ATGATTTTTGGCTTTATTGAATTAAGCTCCATTTCAGGAGTCCTTGTCTCTTATTGTTAT
ATCATCCTATCAGTCTTGAAGATCCACTCTGCTGAAGGGAGGTTCAAAGCTTTCTCCACC
TGTACCTCCCACCTAACTGCTGTGGCCGTTTTCCAGGGAACTATGCTCTTCATGTATTTC
AGGCCGAGTTCATCCTACTCTCTAGATGAAGACAAAATGACCTCATTGTTTTACACCCTT
GTGATTCCCATGTTAAACCCTCTGATTTATAGTTTG


Conceptual translation

MERENCSSLTEFFFLGITDNTENKVILFTMFLPVYLINLLANLGMISLIRMDPQLHTPMY
FFLSHLSFCDLCYSTAIGPKMLVDLFAKNKSISFCGCALQFLVFCTFVDSECLLLAVMAY
DQYKAISSPLLYAVSMSSGVCSLLVAGVYLVGMIDGLINTTLAFRLCFCGSNEINHFFCD
VPPLLLISCSDTQLNELVIFMIFGFIELSSISGVLVSYCYIILSVLKIHSAEGRFKAFST
CTSHLTAVAVFQGTMLFMYFRPSSSYSLDEDKMTSLFYTLVIPMLNPLIYSL