Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR5W2D Olfactory Receptor

Gene Symbol OR5W2D
Organism Cow
Family 5
Subfamily W
Pseudo No
Location chr15:79,725,700-79,726,700 (-)

Sequence information


Nucleotide sequence

ATGAGTAGAGAGAATTGCTCCTCTTTTACTGAGTTCATTTTCTTAGGAATTACTGAGAAC
ACTGAGAACAAAGTGATCCTATTTACAATGTTTTTCCTTTTTTATCTCATCAATCTTTTG
GCAAATCTTGGAATGATCACCCTGATTAGGATGGATCCCCAGCTGCACACACCCATGTAC
TTTTTCCTCAGCCACCTCTCCTTCTGTGACCTCTGCTATTCCACAGCCATTGGCCCTAAG
ATGCTGATGGATCTATTTGCCAAGAACAAGTCAATCTCTTTCTGTGGCTGTGCTCTGCAA
TTCTTGGTCTTCTGTATCTTTGCAGATTCTGAGTGTCTCCTGCTGGCAGTGATGGCCTAT
GACCGGTACAAGGCCATCAGCAGCCTCTTGCTCTATGCAGTCAGCATGTCCAGTGGGGTG
TGCTCCCTGCTCATGGCTGGGGTTTACCTGGTGGGAATGGCAGATGCTCTAATACACATG
ACATTAGCATTCCGTTTATGTTTCTGTGGGTCAAATGTGATTAACCATTTCTTCTGCGAC
TTACCTCCACTTTTCCTCCTTTCCTGCTCTGATATACAGGTCAATGAGTTGGTGTTGTTC
ATTGTTTTCGGTTTCATTGAGCTGAGTACAATTTCAGGAGTTCTTGTCTCTTATTGTTAT
ATCATACTTTCAGTCTTGAAAATCCACTCTGCTGAGGGGAGATTCAAAGCTTTCTCCACC
TGCACTTCCCACCTAATTGCAGTGGCCATTTTCCAGGGAACTCTGCTCTTCATGTATTTC
AGGCCGAGTTCATCCTACTCTCTAGATGAAGACAAAATGACCTCATTGTTTTACACCCTT
GTGATTCCCATGTTAAACCCTCTGATTTATAGTTTGAGGAACAAAGATGTAAAAGAGGCC
CTAGAAAAATTTAAAAATAAACTATATTTTAAAATATTTTTATTATATATCTGTACATAT
GGCTACACACATAGTAATTGCTTAATTACAATTATA


Conceptual translation

MSRENCSSFTEFIFLGITENTENKVILFTMFFLFYLINLLANLGMITLIRMDPQLHTPMY
FFLSHLSFCDLCYSTAIGPKMLMDLFAKNKSISFCGCALQFLVFCIFADSECLLLAVMAY
DRYKAISSLLLYAVSMSSGVCSLLMAGVYLVGMADALIHMTLAFRLCFCGSNVINHFFCD
LPPLFLLSCSDIQVNELVLFIVFGFIELSTISGVLVSYCYIILSVLKIHSAEGRFKAFST
CTSHLIAVAIFQGTLLFMYFRPSSSYSLDEDKMTSLFYTLVIPMLNPLIYSLRNKDVKEA
LEKFKNKLYFKIFLLYICTYGYTHSNCLITII