Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR6A2 Olfactory Receptor

Gene Symbol OR6A2
Organism Cow
Family 6
Subfamily A
Pseudo No
Location chr15:***************** (+)
Aliases OR6A2, ENSBTAG00000019144

Sequence information


Nucleotide sequence

ATGGGCATGACCGACACCATGGAGAGGAAGAACCAGAGTGGGAGAGTGAGTGAGTTTGTG
TTGCTGGGCTTCCCAGCTCCGGTACCACTGCGGGCACTATTATTTGCCCTTTCTCTGTTA
GCCTATGTGTTGGTGCTGACTGAAAACATACTCATCATTGTGGCAATCAGGAGCCACCCC
AGCCTCCACAAACCCATGTATTTCTTTCTGGCTAATATGTCCTTCCTGGAGATTTGGTAC
GTGACAGTCACTATTCCCAAGATGCTAGCTGGCTTTGTTGGGTCCAAACGGGGCCGTGGA
CAGCTAATCTCCTTTGAGGGCTGCATGACGCAGCTCTGCTTTTTCCTGGGCCTGGGCTGC
ACTGAGTGTGTCCTCCTTGCAGTTATGGCTTACGATCGCTATGTGGCCATCTGCCATCCT
CTCCACTACCCTGTCATTGTCAGTGGCCAGCTGTGTGTGCAGCTGGCAGCTGGCTCCTGG
GCAGGAGGTTTTGGCATTTCCATGGTCAAAGTTTTTCTCATTTCTCGCCTCTCTTACTGT
GGCCCCAACATCATCAATCACTTTTTCTGTGATGTCTCTCCATTGCTCAACCTTTCGTGC
ACTGACATGTCCACGGCAGAGCTTACAGACTTTGTCCTGGCCATTTTTATCCTACTGGGG
CCACTCTCTGTCACTGGAGCCTCCTACATGGCCATCACCAGTGCTGTGATGCGCATTCCC
TCAGCTGCTGGGCGCCATAAAGCCTTTTCTACCTGTGCCTCTCACCTTACTGTGGTGGTC
ATCTTCTATGCAGCCAGTATCTTCATCTATGCCCGCCCAAAGGCACTCTCAGCTTTTGAC
ACCAACAAGCTGGTGTCTGTACTTTACGCTGTCATTGTACCACTGCTCAACCCCATCATT
TACTGCCTGCGCAACCAAGAAGTAAAGAGAGCCTTACGCCATACTCTACACCTGCACCAG
GGCCATGACGCTAAC


Conceptual translation

MGMTDTMERKNQSGRVSEFVLLGFPAPVPLRALLFALSLLAYVLVLTENILIIVAIRSHP
SLHKPMYFFLANMSFLEIWYVTVTIPKMLAGFVGSKRGRGQLISFEGCMTQLCFFLGLGC
TECVLLAVMAYDRYVAICHPLHYPVIVSGQLCVQLAAGSWAGGFGISMVKVFLISRLSYC
GPNIINHFFCDVSPLLNLSCTDMSTAELTDFVLAIFILLGPLSVTGASYMAITSAVMRIP
SAAGRHKAFSTCASHLTVVVIFYAASIFIYARPKALSAFDTNKLVSVLYAVIVPLLNPII
YCLRNQEVKRALRHTLHLHQGHDAN