Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR6C2 Olfactory Receptor

Gene Symbol OR6C2
Organism Cow
Family 6
Subfamily C
Pseudo No
Location chr5:58,618,400-58,619,400 (-)

Sequence information


Nucleotide sequence

ATGAGAAATCATACAGTCATAACAACATTCATCTTGTTGGGACTTACAGAGGACCCACAG
CTGCAAGTTCTTGTTTTCGTCTTCTTGTTTCTTACTTACCTGCTGAGCATTACTGGAAAT
CTGACTATTATCATTCTAACATTCCTGGATTCTCATCTTAAAACACCTATGTATTTTTTT
CTTAGAAACTTCTCCTTCTTAGAAATCTCATTCACAACGGTCTGTATTCCCAGATTCCTG
TATAGCATATCAAGTGGGGACAATTCCATTACTTATAACGCCTGTGCTAGTCAAATATTT
TTCATTGGACTTTTTGGGGCCACAGAGTTTTTTCTCCTGGCAGCCATGTCTTATGACCGA
TATGTGGCCATCTGTAAACCCCTTCATTACATGACCATCATGAATGGTAGAGTCTGCACC
ATCCTTGTGTTCTGCTGCTGGATCTCTGGGCTGATGATCATCATCACACCACTCAGTATG
GGCCTCCAGCTAGAATTCTGTGACTCCAATGCCATTGATCATTTTGGCTGTGATGCAGCT
CCTCTTTTTAAGATCTCATGCTCAGATACATGGTTCATTGAACAGATAGTTATAATTTGT
GCAGTGGTGACATTCATCATTACATTGATAGGGGTTGTTCTTTCTTACATGTATATCATC
AGGACAATTCTAAGATTTCCCTCTGCATCACAGAGAAGAAAAGCTTTTTCCACCTGTTCT
TCTCACATGATTGTTGTTTCCATTACCTATGGCAGCTGTATTTTTATCTACATCAAGCCT
TCAGCCAAAGAAGAGGTGGACATTAACAAAGGGGTGTCTGTGCTCACTACATCTGTTGCC
CCGCTGTTGAACCCTGTTATTTATACTTTGAAGAACAAGCAGGTGAAACAAGCTGTCAGT
GACATAATCAAAAAAATTGCATTTTTCTTACACAAT


Conceptual translation

MRNHTVITTFILLGLTEDPQLQVLVFVFLFLTYLLSITGNLTIIILTFLDSHLKTPMYFF
LRNFSFLEISFTTVCIPRFLYSISSGDNSITYNACASQIFFIGLFGATEFFLLAAMSYDR
YVAICKPLHYMTIMNGRVCTILVFCCWISGLMIIITPLSMGLQLEFCDSNAIDHFGCDAA
PLFKISCSDTWFIEQIVIICAVVTFIITLIGVVLSYMYIIRTILRFPSASQRRKAFSTCS
SHMIVVSITYGSCIFIYIKPSAKEEVDINKGVSVLTTSVAPLLNPVIYTLKNKQVKQAVS
DIIKKIAFFLHN