Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR6K4 Olfactory Receptor

Gene Symbol OR6K4
Organism Cow
Family 6
Subfamily K
Pseudo No
Location chr3:11,068,700-11,069,600 (+)

Sequence information


Nucleotide sequence

ATGGTGAGAAGTAACCAAACGTCTATGGTGACAGAATTTTTCTTTTCTGGACTTCCCGAG
CTTGAAGATGGTAACCTCCTCTTCTTTATTCCTTTGTTAGTCATCTACATATTCATCATT
ATTGGGAATCTCATTGTGTTTTTTGCAGTCAGGATAGATACTCATCTGCACAATCCTATG
TATAATTTCATCAGCATATTCTCATTTTTGGAGATCTGGTACACCACAGCCACCATTCCC
AAAATGCTCTCCAATCTTGTCAGTAAGAAGAGGACCATCTCCATAACTGGTTGCCTCTTG
CAGATGTACTTCTTCCACTCACTGGGCAATTCAGAGGGGATTTTGTTGACTACCATGGCC
ATTGACAGGTATGTTGCCATCTGTAATCCTCTCCGCTACCCAACCATTATGACGCCCCGG
CTGTGCACTCAGCTCTCTATAGGCTCCTGTATCTTTGGTTTTCTTTTGTTGCTCCCAGAG
ATTGTATGGATTTCCACACTGCCCTTCTGTGGGCCAAACCAAATCCACCAGATCTTCTGT
GACTTTGAACCTGTGCTATGCTTGGCATGTACAGACACATCCATGATTTTGATTGAGGAT
GTGATCCATGCTATTGCTATCATCTTCTCTGTCTTGATAATTGCCCTCTCATATATCAGA
ATCATCACTGTGATCCTAAGAATTCCCTCTGCTGAAGGCCGTCAGAAGGCCTTTTCTACC
TGTGCATCTCATCTTGGTGTCTTTCTGATGTTCTATGGCAGTGTATCCCTCATGTACCTG
CGTTTCTCTGCCACTTTCCCACCAATTTTGGACACAATCATTGCACTGATGTTTGCAGTT
CTTGCTCCCTTTTTCAATCCTATCATTTACAGCTTGAGAAACAAGGATATGAAGATTGCA
ATTAAGAAGCTTCTCTGCCTTCAGAAAGTATTTTATGCATCTGCAAGT


Conceptual translation

MVRSNQTSMVTEFFFSGLPELEDGNLLFFIPLLVIYIFIIIGNLIVFFAVRIDTHLHNPM
YNFISIFSFLEIWYTTATIPKMLSNLVSKKRTISITGCLLQMYFFHSLGNSEGILLTTMA
IDRYVAICNPLRYPTIMTPRLCTQLSIGSCIFGFLLLLPEIVWISTLPFCGPNQIHQIFC
DFEPVLCLACTDTSMILIEDVIHAIAIIFSVLIIALSYIRIITVILRIPSAEGRQKAFST
CASHLGVFLMFYGSVSLMYLRFSATFPPILDTIIALMFAVLAPFFNPIIYSLRNKDMKIA
IKKLLCLQKVFYASAS