Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR7E186 Olfactory Receptor

Gene Symbol OR7E186
Organism Cow
Family 7
Subfamily E
Pseudo No
Location chr7:15,204,400-15,205,400 (+)

Sequence information


Nucleotide sequence

atgtataacctgagaaatgaaTTGCTTGAGTCCAAAATATGGACACAGTACTGCATGACC
ATTTATGTATTTATATTTTTCCAGTCCTCTTTCCTTCTTCCAAAGGTGTCCAAGCTACAC
AGAACTGGAAATCTAACAAGTGTCTCAGAATTCTTCCTCCAGGGCCTCTCAGATGATCCA
GAACTGCAGCCTTTGCTCTTTACCCTCTTCCTGTCCATGTACCTGGTCACCATGCTGGGG
AACCTGCTCATCATCCTGGCCGTCACCTCTGACCCCCACCTCCACACCCCCATGTACTTC
TTCCTCTCCAACCTCTCCTTGGCTGACATTGGCTTCACCTCCACCACGGTCCCCAAGATG
ATTGTGAACATCCAAACTCACGGCAGAGTCATCTCCTATGCAGGCTGCCTGACACAGATG
TCTATTTTTATCCTTTTTGGATGTATGGATGGTATGCTGCTGTCTGTGATGTCCTATGAC
AGGTTTGTGGCCATCTGTCACCCACTGCACTACCCGGTCATCATGAACCCACACCTCTGT
TGCTCCTTAGTTTTGGTGTCTTTTTTTGGTAGCCTTATGGACTCCCAGGTACACAATCTG
ATTATGCTGCAACTTACCTGCTTTAAAGATGTAGAAATTTCTAATTTCTTCTGTGACCCT
TCTCTGCTCCTCAAGCTTGCCTGTTCTGACATTTTCACCAAAAATATTGTCATATATTTT
ATTGGTGCCATTTTTGCTTTTCTCCCTTTCTCAGGAATCTTTTACTCTTACTATAAAATT
CTTTCCTCCATTTTGAGAGTCCGGTCATCAGGTGGGAGGTATAAAGCCTTCTCCACCTGT
GGCTCTCACCTGGCAGTTGTTTGCTTATTTTATGGAACAGGCCTTGGTGTGTACCTCAGC
TCAGCCATCTCACAATCTCCCAGGAAGGATGCAGTAGCCTCAGTGGTGTACACTGTGGTC
ACCCCCATGCTGAACCCCTTCATCTACAGCCTGAGGAACAGAGACTTCAAAAGGGCCTTT
TGCAGGTTCCTCAACAAAACAATC


Conceptual translation

MYNLRNELLESKIWTQYCMTIYVFIFFQSSFLLPKVSKLHRTGNLTSVSEFFLQGLSDDP
ELQPLLFTLFLSMYLVTMLGNLLIILAVTSDPHLHTPMYFFLSNLSLADIGFTSTTVPKM
IVNIQTHGRVISYAGCLTQMSIFILFGCMDGMLLSVMSYDRFVAICHPLHYPVIMNPHLC
CSLVLVSFFGSLMDSQVHNLIMLQLTCFKDVEISNFFCDPSLLLKLACSDIFTKNIVIYF
IGAIFAFLPFSGIFYSYYKILSSILRVRSSGGRYKAFSTCGSHLAVVCLFYGTGLGVYLS
SAISQSPRKDAVASVVYTVVTPMLNPFIYSLRNRDFKRAFCRFLNKTI