Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR8H4P Olfactory Receptor

Gene Symbol OR8H4P
Organism Cow
Family 8
Subfamily H
Pseudo Yes
Location chr15:80,274,800-80,275,800 (+)

Sequence information


Nucleotide sequence

ATGGGCAGAAGGAATATCACACAGGTGTCTGACTTCATCCTCATGGGACTGACAGATTCT
AAAGAGATCCGGCTGGTCCTCTTCACCCTCTTTCTCCTGATATACCTGATCACTGTGCTG
GGGAATGTGGGGATGATCCTGATAATCTCCCTGGATTCGCAGCTTCACACACCCATGTAT
TTTTTCCTCAGTCACTTGTCATGTCTTGACCTCAGTTACTCAAGTGTCATCACCCCTAAA
ACCTTAGACAACTTACTGACTTCCATCAAAACTATTTCATACGTGAACTGCTTCACTCAG
ATGTCTTTCTTTGTCTTCTTGGGCGCCACTGAATGTGTCCTTCTCTCCTCCATGGCCTAT
GGTCGCTATGCAGCCCTCTGCAGCCCTCTGCGTTACCCCGTTGTTATGTCCACCAGACGC
TGCTAGTCTCTTATCTTTGGATCCTATTTGATTGGCTTTACAGATTCCTTTGTCAATGTG
CTTTGCATGAACAGATTGCATTTCTGTGACTCCAATGTAATCTACCACTTTTTCTGTGAC
ACATCCCCAATTCTATCCCTGTCCTGCACTGACACGCATGACGTTGAAATCATGATATTC
GTTGTCGCTGGCTGTGCCCTAGTGGTGTCTCTTGTCACAATATCCGTGTCCTATGTGTTC
ATACTGTGCACCGTCCTGAAAATCACTTCCACTGCAGGGAAGCAGAAAGCCTTCTCTACC
TGTGCCTCCCATCTCCTGGGAGTAACCATCTTTTATAGCACTATGATTTTCACTTACTTA
AAACCAAGTAAGTCCTACTCCTTGGGAAAGGATCAAGTGGCTTCTGTTTTTTATACTATT
GTCATCCCCATGCTGAACCCCCTTATATACAGTCTTAGAAACAAAGAAGTGAAGAATGCT
GTCGGTAGAGTCATTCAGAAAAGAAAGGTTTCGAAGCAATTAAAA


Conceptual translation

MGRRNITQVSDFILMGLTDSKEIRLVLFTLFLLIYLITVLGNVGMILIISLDSQLHTPMY
FFLSHLSCLDLSYSSVITPKTLDNLLTSIKTISYVNCFTQMSFFVFLGATECVLLSSMAY
GRYAALCSPLRYPVVMSTRRC*SLIFGSYLIGFTDSFVNVLCMNRLHFCDSNVIYHFFCD
TSPILSLSCTDTHDVEIMIFVVAGCALVVSLVTISVSYVFILCTVLKITSTAGKQKAFST
CASHLLGVTIFYSTMIFTYLKPSKSYSLGKDQVASVFYTIVIPMLNPLIYSLRNKEVKNA
VGRVIQKRKVSKQLK