Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR8U9 Olfactory Receptor

Gene Symbol OR8U9
Organism Cow
Family 8
Subfamily U
Pseudo No
Location chr15:80,949,200-80,950,200 (+)

Sequence information


Nucleotide sequence

ATGATCCAGAAAAATTGCAGCCAGGTGACAGAATTTGTTCTCATGGGCCTCACAGATCGT
CAGGAGTTGAAGATCCCCCTCTTTGTCCTGTTCTTATCCATCTACCTCTTCACAGTAGCA
GGCAACCTGGGTCTGATCCTAGTCATCAGAACAGATTCAAGACTCCACACGCCAATGTAC
TTCTTCCTTAGTAACTTGGCTTTTGTTGATTTCTGTTATTCTTCTGTCATTACACCCAAA
ATGCTAGGAAATTTCTTGTACAAACAAAATGTTATCCCTTTCAATGGATGTGCTGCCCAG
CTGGGCTGTTTCCTGGCCTTCATGACTGCCGAGTGTTTGCTGCTGGCTTCCATGGCCTAT
GACCGGTATGTGGCCATCTGTAACCCTCTGCTCTATATGGTCATAATGTCCCCAGGAATC
TGCGTTCAGCTTGTGGCTGCCCCCTATGGCTACAGCTTCCTGGTTGCCCTATTTCATACC
ATCCTCACCTTCCGCCTCTCCTACTGCCATTCCAACCTCATCAATCATTTCTACTGCGAT
GACATGCCTCTTCTCAGGCTCACTAGATCAGACACTCACTCCAAGCAGCTATGGATTTTT
GCCTGTGCTGGCCTCATGCTCATTTCTTCCCTTCTTGTTGTCTTTATCTCCTACATGTAC
ATTATTTCTGCCATCCTGAAGATGCGCTCCGCTGAAGGCAGACGCAAGGCTTTTTCCACC
TGTGGCTCCCACATGCTGGCAGTCACCATATTCTATGGGACCCTCATCTTTATGTACTTA
CAGCCAAGTTCTCATCATTCCCTTGACACGGATAAGATGGCCTCTGTCTTCTATACAGTG
ATCATTCCCATGTTGAACCCTTTAATCTACAGCCTTAGGAATAAGGAAGTGAAAGATGCC
CTGATAAAAGTCATCATGAATAGAAACCAGGCTTTTATGTTCATGAAATTAAGAAAG


Conceptual translation

MIQKNCSQVTEFVLMGLTDRQELKIPLFVLFLSIYLFTVAGNLGLILVIRTDSRLHTPMY
FFLSNLAFVDFCYSSVITPKMLGNFLYKQNVIPFNGCAAQLGCFLAFMTAECLLLASMAY
DRYVAICNPLLYMVIMSPGICVQLVAAPYGYSFLVALFHTILTFRLSYCHSNLINHFYCD
DMPLLRLTRSDTHSKQLWIFACAGLMLISSLLVVFISYMYIISAILKMRSAEGRRKAFST
CGSHMLAVTIFYGTLIFMYLQPSSHHSLDTDKMASVFYTVIIPMLNPLIYSLRNKEVKDA
LIKVIMNRNQAFMFMKLRK