Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Cow symbols

Cow OR9A16 Olfactory Receptor

Gene Symbol OR9A16
Organism Cow
Family 9
Subfamily A
Pseudo No
Location chr4:107,203,000-107,204,000 (+)

Sequence information


Nucleotide sequence

ATGAGCAATCACTCAAGTGCCATGGAATTCTGCCTTTTAGGGTTCCCTGGGTCCCAAGAA
CTACATCACATTCTTTTTGCTATATTCTTTCTCTTCTACTCAGTGACAATAATGGGGAAC
ACCATCATCATTGTGATTATCTGTGTTGATAAACATCTACATTCCCCCATGTATTTCTTC
CTTGGTCATCTCTCTGCCGTGGAAATGCTGGCAACATCTATAATCGTCCCCATGATGCTC
TGGGGGCTGCTGCTCCATGAGATGCAGACAGTATCTCTGACTGCATGTGTCACCCAGCTC
TTCCTGTACCTTGCTCTGGGGACTACAGAGTTTGCACTGTTAGGAGTGATGGCTGTGGAC
CGTTACGTGGCTGTCTGTAACCCTTTGAGGTACAATACCATTATGAACAGCCACACCTGC
ATCTCGGTGGTGATTGGGTCATGGGTGTTTGGGTTCCTTTGTGAAATCTGGCCAGTCTAT
GCCACATTTCAGTTTACCTTCCGCAAATCAAACGTGTTAGACCATTTTTATTGTGACCGA
GGTCAGTTGCTCAAACTATCGTGTGGTGACACTCTTTTCACAGAGTTTGTTCTGTTTTTA
ATGGCTGTTTTCATTGTCGTTGGTTCACTGGTTCCAACAATTGTCTCCTACATCTACATC
ACCTCCACCATCCTCAAGATCCCTACTGCCTCCGGCCGCAGGAAAGCCTTCTCTACGTGT
GCCTCCCACCTCACCTTTGTTGTCATCGGCTATGGCAGCTGCTTGTTCCTCTATGTGAAA
CCCAAGCAAACGCAGGCAGCTGAGTACAATAAGATAGTCTCCCTGTTGATTATTGTGTTA
ACTCCTTTGCTGAACCCCTTCATCTTCACTCTCCGGAATGACAAAGTCAAAGAGGCCCTT
CGAGATGGAGTGAAACGCTGCTGTCAACTCCTCAAGGAT


Conceptual translation

MSNHSSAMEFCLLGFPGSQELHHILFAIFFLFYSVTIMGNTIIIVIICVDKHLHSPMYFF
LGHLSAVEMLATSIIVPMMLWGLLLHEMQTVSLTACVTQLFLYLALGTTEFALLGVMAVD
RYVAVCNPLRYNTIMNSHTCISVVIGSWVFGFLCEIWPVYATFQFTFRKSNVLDHFYCDR
GQLLKLSCGDTLFTEFVLFLMAVFIVVGSLVPTIVSYIYITSTILKIPTASGRRKAFSTC
ASHLTFVVIGYGSCLFLYVKPKQTQAAEYNKIVSLLIIVLTPLLNPFIFTLRNDKVKEAL
RDGVKRCCQLLKD