Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10A4 Olfactory Receptor

Gene Symbol OR10A4
Organism Dog
Family 10
Subfamily A
Pseudo No
Location chr21:30343737-30344708 (+)
Aliases cOR10A17, cOR10A17, cOR10A4P

Sequence information


Nucleotide sequence

ATGCTCAGTGAAATCCTGGGCAGAAGAATGACTTGGAGAAACTGGACAGTTGTCAGTGAG
TTTGTTCTTGTGAGCTTTTCAACTTTGTCCTCTGAGATTCAAGCTCTGCTCTTTTTCCTG
TTTTTGACTATTTACTTGGTTACTCTAATGGGAAATGTTCTCATCATCCTGGTCACTACA
GCTGACTCTGCTCTACAAAATCCCATGTACTTCTTCCTCAGGAACTTGTCCTTCTTGGAG
ATAGGCTTCAACTTAGTCATTGTGCCCAAGATGCTGGATACTCTGATCATCCAGGATGCA
ACCATCTCCTTCCTTGGCTGTGCCACTCAGATGTATTTCTTCTTCTTCTTTGGGGCTGCT
GAGTGCTGTCTCTTGGCCACTATGGCATATGACCGCTATGTGGCCATCTGTGACCCTTTG
CGTTACCCAATCATTATGAACCGCAGAGCCTGTGCCCAGCTAGCAGCTGCCTCTTGGTTC
TCAGGATTTCCAGTGGCCACTGTGCAAACCACATGGATTTTTAGCTTCCCTTTTTGTGGC
CCCAACAGAGTGAACCACTTTTTCTGTGACAGCCCCCCTGTCATTGCACTGGTCTGTGCT
GATACCTCTCTGTTTGAACTGGAGGCTCTGACAGCCACTGTCCTATTTATCCTCTTCCCA
TTCTTGCTGATCCTGGGGTCCTATGTCCGCATCCTCTCCACTATCTTCAGGATGCCCTCA
GCTGAGGGAAAACGTAAGGCCTTCTCTACCTGTTCCTCCCACCTCCTGGTTGTCTCCCTC
TTCTACAGCACCGCCATCCTCACATACTTCCGACCCCGATCGAGTACCTCTCCTGAGAGC
AAGAAACTGCTATCCCTCTCCTACACCGTGGTGACTCCCATGTTGAACCCCATCATTTAC
AGCTTAAGGAATAGTGAAGTGAAGGCTGCACTGAGGCGAGTCCTCCACAGGACCTTGGGC
CCTCAGAAAATC


Conceptual translation

MLSEILGRRMTWRNWTVVSEFVLVSFSTLSSEIQALLFFLFLTIYLVTLMGNVLIILVTT
ADSALQNPMYFFLRNLSFLEIGFNLVIVPKMLDTLIIQDATISFLGCATQMYFFFFFGAA
ECCLLATMAYDRYVAICDPLRYPIIMNRRACAQLAAASWFSGFPVATVQTTWIFSFPFCG
PNRVNHFFCDSPPVIALVCADTSLFELEALTATVLFILFPFLLILGSYVRILSTIFRMPS
AEGKRKAFSTCSSHLLVVSLFYSTAILTYFRPRSSTSPESKKLLSLSYTVVTPMLNPIIY
SLRNSEVKAALRRVLHRTLGPQKI