Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10G9C Olfactory Receptor

Gene Symbol OR10G9C
Organism Dog
Family 10
Subfamily G
Pseudo No
Location chr5:10,469,100-10,470,100 (+)
Aliases cOR10G12P

Sequence information


Nucleotide sequence

ATGACAAACAGGAGCTTTGTAACTACATTCATCCTCATGGGCCTTCCCCATGCACCAGCC
CTGGACATCCCCCTCTTCACAATCTTCTTAGTGATTTATGTACTCACCGTGATGGGGAAC
CTCCTCATCCTGCTGGTGATCAGGGTGGATTCTCACCTCCACACCCCCATGTACTACTTC
CTGACCAACCTGTCCTTCATTGACATGTGGTTCTCCACAGTCACTGTGCCCAAAATGCTG
ATGACCTTGGGGTCTCCAGGAGGCAGGATGATCTCCTTTCACAGCTGCATGGCTCAGCTC
TACTGCTTCCACTTCCTGGGCAGCACCGAGTGTTTCCTCTACACAGTCATGTCCTATGAC
CGCTACCTGGCCATCAGTCACCCACTCAGGTACACCAGCATGATGAGGGGGAGAACGTGT
GCCCTCCTGGCCACCGGCACGTGGCTCAGTGGCTCTCTGCACTCTGCTGTCCAGACCACG
CTGACATTCCGTTTGCCCTACTGTGGGCCCAGCCAGATCCAGCATTACTTCTGTGATGGA
CCTCCCATCCTCAGGCTGGCCTGTGCAGACACCTCCGTGAACGAGATGGTGATCTTTGTC
AACATTGGGGTGGTGGCCTCGGGCTGCTTCCTCCTCATAGTGTTGTCCTATGTGTCCATC
GTCTGTTCCATCCTGAAGATCCGCACCTCAGAGGGGAGGCATAGAGCCTTTCAGACCTGC
ACCTCCCACTGCATTGTGGTCCTTTGCTTCTTTGTTCCCTGTGTTTTCATCTACCTGAGG
CCAGGCTCCAGGGATGCTGTGGATGGGGTCGTGGCAGTCTTCTACACGGTGCTGACACCC
CTTCTAAACCCTGTGGTGTACACCCTGAGGAACAAGGAAGTGAAGAAAGCTCTGTTGAAG
CTTAAAGACAAAATAACACAGTCCCAGAGCAAA


Conceptual translation

MTNRSFVTTFILMGLPHAPALDIPLFTIFLVIYVLTVMGNLLILLVIRVDSHLHTPMYYF
LTNLSFIDMWFSTVTVPKMLMTLGSPGGRMISFHSCMAQLYCFHFLGSTECFLYTVMSYD
RYLAISHPLRYTSMMRGRTCALLATGTWLSGSLHSAVQTTLTFRLPYCGPSQIQHYFCDG
PPILRLACADTSVNEMVIFVNIGVVASGCFLLIVLSYVSIVCSILKIRTSEGRHRAFQTC
TSHCIVVLCFFVPCVFIYLRPGSRDAVDGVVAVFYTVLTPLLNPVVYTLRNKEVKKALLK
LKDKITQSQSK