Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10H4 Olfactory Receptor

Gene Symbol OR10H4
Organism Dog
Family 10
Subfamily H
Pseudo No
Location chr20:46494276-46495304 (-)
Aliases cOR10H10, cOR10H10

Sequence information


Nucleotide sequence

ATGACACTGTCTCATCCTTGTCCTTCATGGAATAAATCATGTATCTTCATATCCTTTCTG
GCCTCAGCAGATGCAGCTTCCGTGGCTGGTCAGAACTATAGCATGGTGTCTGAATTCATC
CTCGTGGGCTTCTCCACCTTCCCACAGCATCTCCTGCCTGTCTTCTTTCTGTTCTACTTG
CTGATGTACCTGTTCACGCTGCTGGGGAACCTGCTCATCATGGCTACTGTCTGGAGTGAG
CGCAGCCTGCACACGCCCATGTACCTCTTCCTGTGTGCCCTGTCCATCTCTGAGATTCTG
TTCACTGTTACCCTCACCCCCCGCATGCTGGTTGACATGCTCTCCAGCCACCGCTCCATC
ACCTTTGTGGCCTGTGCCACCCAGATGTTCTTCTCCTTCACGTTTGGCTTCACCCATTCC
TTCTTGCTCATGATCATGGGCTATGACCGCTACGTGGCCATCTGCCACCCCCTGCGCTAC
AACGTGCTCATGAGCCCCCGTGGATGTGCCCGCCTCGTGTCCTGGACCTGGGCTGGTGGC
TCAGTCATGGGGATGATGGTGACCCTGATAGTTTTTCATCTCACCTTCTGTGGGTCTAAC
GTGATCCACCATTTTGCTTGCCATGTGCTTTCCCTCCTACAGTTGGCCTGTGGGAAGGAG
ACATTCTCTGTCACCTTGGGAGTGATTCTGGTGTGTGTCTCAGCTCTGATGGGCTGCTTA
TCCCTCATCGTCCTCTCTTATGTCTTCATCGTGGCTGCCATCTTGAGGATCCCGTCTGCT
GAGGGCAGACACAAGACCTTCTCCACCTGTGTGTCCCACCTCACTGTGGTCATTGTGCAC
TATGGTTTTGCCTCCATTATCTACCTCAAGCCCAAGGGCCCCCATTCTACGGACAGTAAC
ACTCTAATGGCCACCACCTATATAGTCTTCACCCCGTTTCTCAGCCCAATCATTTTCAGC
CTCAGGAATAAGGAGCTCAAGAATGCCATAAAGAAAAGCTTCCAGAGAAAATTCAGTCCC
CTTAGCTCC


Conceptual translation

MTLSHPCPSWNKSCIFISFLASADAASVAGQNYSMVSEFILVGFSTFPQHLLPVFFLFYL
LMYLFTLLGNLLIMATVWSERSLHTPMYLFLCALSISEILFTVTLTPRMLVDMLSSHRSI
TFVACATQMFFSFTFGFTHSFLLMIMGYDRYVAICHPLRYNVLMSPRGCARLVSWTWAGG
SVMGMMVTLIVFHLTFCGSNVIHHFACHVLSLLQLACGKETFSVTLGVILVCVSALMGCL
SLIVLSYVFIVAAILRIPSAEGRHKTFSTCVSHLTVVIVHYGFASIIYLKPKGPHSTDSN
TLMATTYIVFTPFLSPIIFSLRNKELKNAIKKSFQRKFSPLSS