Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10H4C Olfactory Receptor

Gene Symbol OR10H4C
Organism Dog
Family 10
Subfamily H
Pseudo No
Location chr20:46507601-46508527 (-)
Aliases cOR10H15P, cOR10H15P

Sequence information


Nucleotide sequence

ATGGTGTCTGAATTCATTCTCGTGGGCTTCTCCACCTTCCCACAGCATCTCCTGCCTGTC
TTCTTTCTGTTCTACTTGCTGATGTACCTGTTCACGCTGCTGGGGAACCTGCTCATCATG
GCTACTATTTGGAGTGAGCGCAACCTGCACACGCCCATGTACCTCTTCCTGTGTGCCCTG
TCCACCTCTGAGATTCTGTTCACTGTTGCCGTCACCCCCCGCATGCTGGTTGACATGCTC
TCCAGCCACCGTTCCATCACCTTTGTGGCCTGTGCCACCCAGATGTTCTTCTCCTTCACG
TTTGGCTTCACCCATTCCTTCTTGCTTATGATCATGGGTTATGACCGCTATGTGGCCATC
TGCCACCCCCTACGCTACAACGTGCTCATGAGCATCCGCACCTGTGCCCGTTTGGTGTCC
TGGACCTGGGCTGGTGGCTCAGTCATGGGGATGATGGTGACCCTGATAGTTTTTCACCTC
ACCTTCTGTGGGTCTAATGTGATTCATCATTTTCTCTGCCATGTGTTTTCCCTCTTAAAG
TTGGCTTGTGGGAATGAGAATTCCTCAGTCACCTTGGGTGTGATCCTTGTGTGTGTCTCA
GCTCTGATGGGCTGTTTATTCCTCATCATCCTCTCCTATATCTTCATCGTGGCGGCCATA
TTGAGGATCCCCTCTGTTGAGGGAAGGCACAAGACCTTCTCCACCTGTGTGTCCCACCTC
ACTATTGTTATTGTGCACTACAGTTTTGCCTCCATTATCTACCTCAAGCCGAAGGGCCCC
CATTCTATGGACAGTAACACCCTGATGGCCACCACCTATACAGTCTTTACCCCGTTTCTC
AGCCCAATCATTTTTAGCCTCAGGAATAAGGAGCTCAAGAATGCCATAAAGAAAAGCTTC
CAGAGAAAATTCAGTCCCTTACGCTCC


Conceptual translation

MVSEFILVGFSTFPQHLLPVFFLFYLLMYLFTLLGNLLIMATIWSERNLHTPMYLFLCAL
STSEILFTVAVTPRMLVDMLSSHRSITFVACATQMFFSFTFGFTHSFLLMIMGYDRYVAI
CHPLRYNVLMSIRTCARLVSWTWAGGSVMGMMVTLIVFHLTFCGSNVIHHFLCHVFSLLK
LACGNENSSVTLGVILVCVSALMGCLFLIILSYIFIVAAILRIPSVEGRHKTFSTCVSHL
TIVIVHYSFASIIYLKPKGPHSMDSNTLMATTYTVFTPFLSPIIFSLRNKELKNAIKKSF
QRKFSPLRS