Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10H4D Olfactory Receptor

Gene Symbol OR10H4D
Organism Dog
Family 10
Subfamily H
Pseudo No
Location chr20:46,486,600-46,487,600 (+)
Aliases cOR10H20, cOR10H12P

Sequence information


Nucleotide sequence

ATGGTGTCTGAATTCATCCTCGTGGGCTTCTCCACCTTCCCACAGCATCTCTTGCCTGCC
TTTTTCCTGTTCTACTTGCTGATGTACCTGTTCACGCTGCTGGGGAACCTGCTCATCATG
GCTACTGTCTGGAGTGAGCGCAGCCTGCACACACCCATGTACCTCTTCCTGTGTGCCCTG
TCCACCTCTGAGATTCTCTTCACTGTTGCCATCACCCCCCGCATGCTGGTTGACATGCTC
TCCAGCCACCGCTCCATCACTTTTATGGACTGTGCCACCCAGATGTTCTTCTCCTTCACG
TTTGGCTTCACCCATTCCTTCTTGCTCATGATCATGGGCTATGACCGCTATGTAGCCATC
TGCCACCCCCTGCGCTACAACATGCTCATGAGCACCCGCACCTGTGCCCGTTTGGTGTCC
TGGACCTGGGCTGGTGGCTCAGTCATGGGGATGATGGTGACCCTGATAGTTTTTCATCTC
ACCTTCTGTAAGTCTAATGTGATTCATCATTTTTTCTGCCATGTGCTTTCCCTCCTAAAG
TTGTCTTGTGGGAATGAGAATTCCTCTGTCACCTTGAGAGTGATTCTGGTGTGTGTCTCA
GCTCTGATGGGCTGCTTATTCCTCATCGTCCTCTCCTACATCTTCATTGTGGCCGCCATA
TTGAGGATCCCCTCTGCTGAGGGCAGACACAAGACATTCTCTACCTGTGTGTCCCACCTC
ACTATTGTTATTGTGCACTATGGTTTTGCCTCCATTATCTACCTCAAGCCCAAGGGCCCC
CATTCTATGGACAGTAACACCCTGATGGCCACCACATATACAGTCTTCACCCCGTTTCTC
AGCCCAATCATTTTCAGCCTCAGGAATAAGGAGCTCAAGAATGCCATAAAGAAAAGCTTC
CAGAGAAAATTCAGTCCCCTAAGTTCC


Conceptual translation

MVSEFILVGFSTFPQHLLPAFFLFYLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCAL
STSEILFTVAITPRMLVDMLSSHRSITFMDCATQMFFSFTFGFTHSFLLMIMGYDRYVAI
CHPLRYNMLMSTRTCARLVSWTWAGGSVMGMMVTLIVFHLTFCKSNVIHHFFCHVLSLLK
LSCGNENSSVTLRVILVCVSALMGCLFLIVLSYIFIVAAILRIPSAEGRHKTFSTCVSHL
TIVIVHYGFASIIYLKPKGPHSMDSNTLMATTYTVFTPFLSPIIFSLRNKELKNAIKKSF
QRKFSPLSS