Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10H4E Olfactory Receptor

Gene Symbol OR10H4E
Organism Dog
Family 10
Subfamily H
Pseudo No
Location chr20:46525196-46526116 (+)
Aliases cOR10H18, cOR10H18, cOR10H14P

Sequence information


Nucleotide sequence

ATGGTGTCTGAATTCATCCTCGTGGGCTTCTCCACCTTCCCACAGCATCTCCTGCCTGCC
TTCTTTCTGTTCTACTTGCTGATGTACCTGTTCACGCTGCTGGGGAACCTGCTCATCATG
GCTACTGTCTGGAGTGAGCGCAGCCTGCACACGCCCATGTACCTCTTCCTGTGTGCCCTG
TCCACCTCTGAGATTCTGTTCACTGTTGCCGTCACCCCCCGCATGCTGGTTGACATGCTC
TCCAGCCACCACTCCATCACCTTTGTGGCCTGTGCCACCCAGATGTTCTTCTCCTTCATG
TTCGGCTTCACCCATTCCTTCTTGCTTATGATCATGGGTTATGACCGCTACGTGGCCATC
TGCCACCCCCTACGCTACAACGTGCTCATGAGCATCCGCACCTGTGCCCGTTTGGTGTCC
TGGACCTGGGCTAGTGGCTCAGTCATGGGGATGATGGTGACCCTGATAGTTTTTCACCTC
ACCTTCTGTGGGTCTAATATGATCTACCATTTTGGCTGCCATGTGTTTTCCCTCTTAAAG
TTGGCCTGTGGGAAGGAGACATCCTCGGTTACATTGGGTGTGATCCTCGTGTGTGTCTCA
GCTCTGATGGGCTGTTTATTCCTCATCGTCCTCTCTTATGTTTTCATCGTGGCTGCCATA
TTAAGGATCCCCTCTGCTGAGGGCAGAACCAAGACCTTCTCCACGTGTGTCTCCCACCTC
ACTGTGGTCATTGTGCACTATGGTTTTGCCTCCATTATCTACCTCAAGCCCAGGAGCTCT
ATGGACAGTAACACCCTGATGGCCACCACCTATACAGTCTTCACCCCATTTCTCAGCCCA
ATCATTTTCAGCCTCAGGAATAAGGAGCTCAAGAATGCCATAAAGAAAAGCTTCCAGAGA
AAATTCCGTCCCCTAGGCTCC


Conceptual translation

MVSEFILVGFSTFPQHLLPAFFLFYLLMYLFTLLGNLLIMATVWSERSLHTPMYLFLCAL
STSEILFTVAVTPRMLVDMLSSHHSITFVACATQMFFSFMFGFTHSFLLMIMGYDRYVAI
CHPLRYNVLMSIRTCARLVSWTWASGSVMGMMVTLIVFHLTFCGSNMIYHFGCHVFSLLK
LACGKETSSVTLGVILVCVSALMGCLFLIVLSYVFIVAAILRIPSAEGRTKTFSTCVSHL
TVVIVHYGFASIIYLKPRSSMDSNTLMATTYTVFTPFLSPIIFSLRNKELKNAIKKSFQR
KFRPLGS