Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10J5 Olfactory Receptor

Gene Symbol OR10J5
Organism Dog
Family 10
Subfamily J
Pseudo No
Location chr38:22531168-22532331 (+)
Aliases cOR10J22, cOR10J22

Sequence information


Nucleotide sequence

ATGAAGCACTGTATCAAAGCCCTTGGGGGTGTGTGTGAGGTGGGCTTTTATTCAGGAATA
ACCAGCCTGAGCTCGCTGGTCAAGGGGAGGGAGTCGGGCTCACTCTCTGGCTTCACTGTC
CTGGTCTCTCCCCATGGAGTCCAGCTGCTGAGGGGGATGTTCTCCTTGATGACTTCCTTT
CTTGCTTGCAGACCCTGGTCTAGCAGAATGCAGAGAAAGAACTTCACGGAAGTGACAGAT
CTCATCTTCCTGGGATTTTCTATCTTTGGAAAGCACCAGCTAACGCTCTTTGTGGTTTTC
CTGACTGTCTACATTTTAACTCTAACTAGTAATGTCATCATTGTGACCATCATCCGTGTT
GACCGCCACCTGCACACGCCCATGTACTTCCTCCTGAGCATGCTGGCCAGTTCTGAGACT
GTGTACACACTGGTCATTGTCCCACGAATGCTTTCCAGTCTCCTTTTTCATAACCAGCCC
ATCTCCTTGGCAGGCTGTGCAACTCAGATGTTCTTCTTTGTCACCTTGGCCACCAGTAAC
TGCTTCTTGCTTACAGCGATGGGCTATGACCGCTACCTGGCGATCTGCAGCCCCCTGTGG
TACACGGTCCTCATGAGCAAAGGAGTGTGTGCCACCTTGGTATGCGGGTCCTTCGGTACC
GGCCTGGCTATGGCAGTTCTCCATGTGGCAGCAATGTTCAACTTGCCCTTCTGTGGCACA
GTGGTGGAGCACTTCTTCTGTGACATTTACCCAGTCATGAAACTTTCCTGTGTTGATACC
ACTATCAATGAGATGATCAATTATGCTGTCAGTTCATTTGTGATCCTGGTCCCTGTGGGC
TTGATCTTCATCTCCTATGTCTTCATCATCTCTGCCATTCTCAAGATTGCCTCCGCAGAA
GGCCGGAAGAAGGCCTTTGCCACCTGCACCTCCCACCTCACCGTGGTCATCGTCCACTAC
GGCTGCGCCTCCATCGCCTACCTCAAGCCCAAGTCGGAGAACTCCATAGAACAAGACCTC
CTTCTCTCGGTGACTTATACCATCATCACGCCTCTGCTCAACCCTGTTGTCTACAGCCTG
AGGAACAAGGAGGTCAAAGATGCCCTCCGCAGAGCTGTGGGCAAAAACATCATAACAGAT
CGAATCGCTTTGTCAGGAGACGTT


Conceptual translation

MKHCIKALGGVCEVGFYSGITSLSSLVKGRESGSLSGFTVLVSPHGVQLLRGMFSLMTSF
LACRPWSSRMQRKNFTEVTDLIFLGFSIFGKHQLTLFVVFLTVYILTLTSNVIIVTIIRV
DRHLHTPMYFLLSMLASSETVYTLVIVPRMLSSLLFHNQPISLAGCATQMFFFVTLATSN
CFLLTAMGYDRYLAICSPLWYTVLMSKGVCATLVCGSFGTGLAMAVLHVAAMFNLPFCGT
VVEHFFCDIYPVMKLSCVDTTINEMINYAVSSFVILVPVGLIFISYVFIISAILKIASAE
GRKKAFATCTSHLTVVIVHYGCASIAYLKPKSENSIEQDLLLSVTYTIITPLLNPVVYSL
RNKEVKDALRRAVGKNIITDRIALSGDV