Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10K1 Olfactory Receptor

Gene Symbol OR10K1
Organism Dog
Family 10
Subfamily K
Pseudo No
Location chr38:23236780-23237718 (-)
Aliases cOR10K3, cOR10K3

Sequence information


Nucleotide sequence

ATGGAGCGGGGCAACGAGACCCTGGTGAGGGAGTTCATCTTCCTTGGCTTCTCTTCTCTG
GCCGGGCTGCAGCGGCTGCTCTTCGTCGCCTTCCTGCCCCTCTACCTGTTCACTCTGGGC
ACCAATGCCATCATCATTTCCACCATCGTGCTGGACAGAGCCCTGCACACCCCCATGTAC
TTCTTCCTGGCCGTCCTCTCCTGCTCCGAGACCTGCTACACCTTTGTCATCGTCCCCAAG
ATGCTGGTGGACCTGCTGGCCCAGAAGAAGACCATCTCCTTCGTGGGCTGTGCCATCCAG
ATGTTCACCTTCCTCTTCCTCGGCTGCTCTCACTCCTTCCTGCTGGCAGCCATGGGGTAT
GACCGCTACGTGGCCATCTGTAACCCTCTGCGTTACACAGAGCTCATGGGACCTCGGGTG
TGTGTGGGACTCGTGGCTGCTGCCTGTGCCTGTGGCTTGACTATTGCCCAGATTGTCACC
TCCCTGGTGTTTCACCTGCCCTTCCTCTCCTCCAACCAGCTGCATCACTACTTCTGCGAC
ATCTCTCCTGTCCTCAAGGTGGCGTCCCATCACTCGCGCCTCAGTCAGTTGGTCATATTC
ATGATTGGTGTGTGTGTGTTGGTCGTCCCCCTCCTCCTCATCCTGGTCTCTTACATCCGC
ATCATTTCTGCCATTTTGAAGATCCCATCCTCCACCGGCAGGTACAAGGCCTTCTCCACC
TGTGCCTCCCACCTCATTGTGGTTACTGTGCATTACGGTTGTGCCTCTTTCATCTACTTA
AGGCCCAAATCCAGCTACTCTTCAAGTCAGGACACGCTCATATCTGTGTCCTACACCATC
CTCACTCCACTCTTCAATCCAATGATTTATAGCCTGAGGAACCAGGAATTCAAGGCAGCC
TTTCGAAGAGTAATGGGCCAGACTTTGTATCCTCCTCAC


Conceptual translation

MERGNETLVREFIFLGFSSLAGLQRLLFVAFLPLYLFTLGTNAIIISTIVLDRALHTPMY
FFLAVLSCSETCYTFVIVPKMLVDLLAQKKTISFVGCAIQMFTFLFLGCSHSFLLAAMGY
DRYVAICNPLRYTELMGPRVCVGLVAAACACGLTIAQIVTSLVFHLPFLSSNQLHHYFCD
ISPVLKVASHHSRLSQLVIFMIGVCVLVVPLLLILVSYIRIISAILKIPSSTGRYKAFST
CASHLIVVTVHYGCASFIYLRPKSSYSSSQDTLISVSYTILTPLFNPMIYSLRNQEFKAA
FRRVMGQTLYPPH