Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10P24P Olfactory Receptor

Gene Symbol OR10P24P
Organism Dog
Family 10
Subfamily P
Pseudo Yes
Location chr10:50,608-51,535 (+)
Aliases cOR12H1P

Sequence information


Nucleotide sequence

ATGGCTGAGGAAAATCAGACTCTGCCTGAATCTCTCCTAGGATTTTCTGACTTCAGGGCT
CTGCAGGGCCCCCTGTTCTGGATGGTACTTCTGGTTTAGGGTCACCTTGCTGGGTAACTG
TGCCATCATCCTCCTCACACAGGCGAGCATCCCTGCATTCCCCCATGTACTTCCTCCTGC
GCCACCTCTCTGTGGTGGAGCTCCTGTACACCACGGACATTGTGCCCAGGACCCTGGTTG
ACCTGGCCTCCCCATACCCCGGGCCATCTCCTTCCAGAGCTGTGTGGCCCAGATGTACGT
CTTCATGGTCCTGGGCATCTCAGAGTGCTGCCTCCTCACAGCCATGGCCTATGACCACTA
TGCAGCCATCTGTCAGCCCCTGCACTATGCCACCCTCATGAGCTGGAGGGCCTGCACGGC
TATGGTGGGTGTCTCCTGGCTCATGGGCATCGTCACAGCCACCACCCATTCCACTCTCAT
CTTCACTCTGCCCTTCCCCAGCCACCCCATCATCCTGCACTTCCTCTGTGACATCCTGCC
AGTACTGAGGCTGGCAAGTGCTGGGAAACACGAGAGTGAAATCTCCGTGATGACAGCCAC
CGTGGTCTTCATCATGGTCCCCTTCTCTCTGATCATTGCCTCTTATGCCTGCATTCTGAG
TGCCAACCTGGCAATGGCCTCCACCCAGAGCCGTCACAAGGTCTTCTCTACTTGCTCCTC
CCACCTGCTTGTGGTCTTCCTCTTCTTTGGAACAGCCAGCATCACCTACATCCAGCCCCG
GACTGGCTCCTCTGTTACCATGAACCGCATCCTCAGCCTCTTCTACACAGTCATCACACC
CATGCTCAACCCCATCATCTACACCCTTCGCAACAAGGAGGTGGCAAGGGCCCTGCAGCG
CATGGTGAAGAGGGAGGTCTCCTCACCA


Conceptual translation

MAEENQTLPESLLGFSDFRALQGPLFWMVLLV//VTLLGNCAIILLT\RASLHSPMY
FLLRHLSVVELLYTTDIVPRTLVDLASPY/RAISFQSCVAQMYVFMVLGISECCLLTAM
AYDHYAAICQPLHYATLMSWRACTAMVGVSWLMGIVTATTHSTLIFTLPFPSHPIILHFL
CDILPVLRLASAGKHESEISVMTATVVFIMVPFSLIIASYACILSANLAMASTQSRHKVF
STCSSHLLVVFLFFGTASITYIQPRTGSSVTMNRILSLFYTVITPMLNPIIYTLRNKEVA
RALQRMVKREVSSP