Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10Q2 Olfactory Receptor

Gene Symbol OR10Q2
Organism Dog
Family 10
Subfamily Q
Pseudo No
Location chr18:38098986-38099942 (+)
Aliases cOR10Q5, cOR10Q5

Sequence information


Nucleotide sequence

ATGTTCGCTAGGAGCCCTGTCCTCAACCAATCCGGCCCCACTGAGTTCTTCTTCCGCGTG
TTGACCACCGTCCCAGAATTCCAGGCCCTGCTCTTCCTCCTCTTCCTCCTCCTCTACTTG
ATGATCCTCTGTGGCAACACAGCCATCATCTGGGTGGTGTGCACGCACAGCTCCCTCCGC
ACCCCCATGTACTTCTTCCTCTGCAACCTGGCCTTTGTAGAGATCAGCTACACCACGGTG
GTGGTGCCTCTGATGCTTTCCAACATTTGGGGAGCCCCGAAGCCCATCCCCCTGGCTGGC
TGTGGGGCCCAGATGTTCTTTTTTCTCACTCTTGGTGGTGCTGACTGCTTTCTCTTGGCA
ATCATGGCCTACGATCGCTATGTGGCCATCTGCCACCCGCTGCACTACACCCTCATCATG
ACCCAGAAGCTGTGCGCCCAGATGGTGGCGTGCGCGGTGGGCCTGGCCCTGGTCCTCTCC
CTGCAGCTCACGTCCTTAATCTTCACCCTGCCCTTCTGCGGGCACCGCCAGGAGATCAAC
CACTTCCTGTGCGATGTGCCCCCGGTCCTGCGGCTGGCCTGCGCCGACATCCGCGTGCAC
CAGGCCGTCCTCTACGTGGTGGGCATCCTCGTGCTGACCGTCCCCTTCCTGCTCATCTGT
GTGTCCTATGTGTTCATCGCCTCGGCCATCCTGCGCATCCGCTCCGCCGAGGGCCGCCGC
CGGGCCTTCTCCACCTGCTCCTCGCACCTCACCGTGGTCCTGCTGCAGTACGGCTTCTGT
GCCGTGGTCTACCTGCGGCCCCAGTCCACCTCCTCGGTGGACGAGGACCGCCAGTTTGCC
CTGGTCTACACCTTTGTCACCCCCCTCCTCAACCCGCTGATTTACACCCTCAGAAACAAA
GATGTCAAAGGTGCTTTGAAAAAGGCCATCAGTAGCAAAGCAGCATCTGAAGCTCTC


Conceptual translation

MFARSPVLNQSGPTEFFFRVLTTVPEFQALLFLLFLLLYLMILCGNTAIIWVVCTHSSLR
TPMYFFLCNLAFVEISYTTVVVPLMLSNIWGAPKPIPLAGCGAQMFFFLTLGGADCFLLA
IMAYDRYVAICHPLHYTLIMTQKLCAQMVACAVGLALVLSLQLTSLIFTLPFCGHRQEIN
HFLCDVPPVLRLACADIRVHQAVLYVVGILVLTVPFLLICVSYVFIASAILRIRSAEGRR
RAFSTCSSHLTVVLLQYGFCAVVYLRPQSTSSVDEDRQFALVYTFVTPLLNPLIYTLRNK
DVKGALKKAISSKAASEAL