Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR10T2 Olfactory Receptor

Gene Symbol OR10T2
Organism Dog
Family 10
Subfamily T
Pseudo No
Location chr38:23283312-23284256 (+)
Aliases cOR10T4, cOR10T4

Sequence information


Nucleotide sequence

ATGCACAGTTTCAATAGAACCACTATGGTTACACGGTTTGTCCTGGTGGGCTTCTCTAGC
CTGGGGGAGCTCCAGCTACTGCTGTTTGTCATCTTCCTTCTCCTGTATTTGACAATCCTA
CTGGCCAATGCAACCATCATGGCTGTTATCCGCTGCAGCCGGACTCTACACACTCCCATG
TATGGTTTCTTATTCATCCTTTCCTTTTCTGAGTCCTGCTACACATTTGTCATCATCCCT
CAGCTGCTGGTCCACCTGCTCTCAGCCACCAAGAGCATCTCCTTTGTGGCCTGTGCTGCC
CAGCTTTTCTTCTTCCTTGGCTTTGCCTGCACCAACTGCTTTCTCATCGCTGTGATGGGG
TATGACCGCTACGTGGCAATTTGCCAGCCTCTGAGGTATACACTTGTCATGAACAAAAGG
CTAGGGTTGGGGTTGGTTTCCCTGTCTGGAGTCACAGGTTTCTTCATTGCTTTGGTGGCC
ACCAATCTCATCTGTGACATGCCCTTCTGTGGCCCCAACAGGGTCAACCACTACTTCTGT
GACATGGCACCTGTTATTAAGTTGGCCTGCACAGACACCCATGTGAAAGAACTGGCTCTA
TTCAGCCTCAGCATCTTGGTGATCATGGTGCCTTTCCTGCTAATTCTCATCTCCTATGGC
TTCATCCTTAATACCATCCTGAAGATCCCCTCGGCTGAGGGAAAAAGGAAGGCCTTTGCC
ACCTGCGCCTCCCACCTCACAGTGGTCATCGTGCACTACGGCTGTGCGTCCATCATCTAC
CTGAGGCCCAGATCCAAGTCTGCCTCAGACAAGGATCAGTTGGTGGCAGTGACCTATACT
GTGGTTACTCCCCTACTTAATCCCCTTGTCTACAGTCTGAGGAATCAGGAGGTGAAGACT
GCCCTCAAAAGAGTTCTGGGGATGCCTGTGGCAACCAAAGTAATC


Conceptual translation

MHSFNRTTMVTRFVLVGFSSLGELQLLLFVIFLLLYLTILLANATIMAVIRCSRTLHTPM
YGFLFILSFSESCYTFVIIPQLLVHLLSATKSISFVACAAQLFFFLGFACTNCFLIAVMG
YDRYVAICQPLRYTLVMNKRLGLGLVSLSGVTGFFIALVATNLICDMPFCGPNRVNHYFC
DMAPVIKLACTDTHVKELALFSLSILVIMVPFLLILISYGFILNTILKIPSAEGKRKAFA
TCASHLTVVIVHYGCASIIYLRPRSKSASDKDQLVAVTYTVVTPLLNPLVYSLRNQEVKT
ALKRVLGMPVATKVI