Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR11H12 Olfactory Receptor

Gene Symbol OR11H12
Organism Dog
Family 11
Subfamily H
Pseudo No
Location chr15:17396655-17397731 (+)
Aliases cOR11H9, cOR11H9

Sequence information


Nucleotide sequence

ATGCCATGCTCATTGTCTTCTCTTCTTTCTGAAAAAGGAGCACATTTGAAACTAGTCCTG
ATAACAGTATGTCTCTTGCCCTTGCAGATGACTGACCCAGTGAATGTCTCTGAGCCATAT
TCCAGCTTCGCTTCTGTAAGAGAATTTATACTCCTAGGTTTCTCTTGTGAGTGGAAGATT
CAGATCCTCCTCTTCTCACTCTTCACTACAACGTATACTTTGACGGTAACAGGGAATGGG
GCCATTGTTTGTGCTATTTGGTGTGAAGGGAGACTCCATAGCCCCATGTACATGTTCCTG
GGGAATTTCTCCTTTCTAGAGATCTGGTATGTCTCTTCTACAGTCCCCAATATGTTGGCC
AATTTCCTCTCAGAAAAAAAGACCATCTCCTTTACTGGATGTTTCGTCCAATTTTATTTC
TTTTTCTCTTTGGGAACTTCTGAATGTTTGCTCTTGGCCATCATGGCCTTTGATCGGTAC
CTTGCTATCTGCCGTCCCTTGCACTACCCTAATATCATGACTAGGTATTTATCTACCAAA
CTGGTCATTATCTGCTGGGTTTGTGGTTTTCTGTTGTTCCTGATCCCCATTGCATTCATC
TCTCAGATGCCCTTCTGTGGTCCAAACATTATTGACCATGTTGTGTGTGACCCAGGGCCA
CTGTTTGCATTGGCATGTGCATCTGCCCCAACAATCCAACAGCTTTGCTATAGTCTAAGC
TCATTAGTTATCTTTGGTAACTTCCTTTTCATCCTTGGGTCCTATACACTTGTCCTGTTA
GCTGTGTTGCACATGCCTTCAACCCTCGGGAGACATAAGGCCTTCTCTACCTGTGGTTCT
CATTTGGCTGTGGTATCACTATTCTATGGCTCTCTGATGATCATGTATGTGAGCCCAGGA
CTTGGGCATTCTGCAGGTATACAGAAAGTTGCAACTTTGTTCTATGCTATGGTAACTCCA
CTCTTCAACCCGCTCATCTATAGCCTCCGGAATAAGGAGATAAAGGCAGCCCTGAGGAAA
GTTCTGGGGCGTTGCTACATGACCCAAGATGTACTATGTGATTGCTCCAGGTCAGTA


Conceptual translation

MPCSLSSLLSEKGAHLKLVLITVCLLPLQMTDPVNVSEPYSSFASVREFILLGFSCEWKI
QILLFSLFTTTYTLTVTGNGAIVCAIWCEGRLHSPMYMFLGNFSFLEIWYVSSTVPNMLA
NFLSEKKTISFTGCFVQFYFFFSLGTSECLLLAIMAFDRYLAICRPLHYPNIMTRYLSTK
LVIICWVCGFLLFLIPIAFISQMPFCGPNIIDHVVCDPGPLFALACASAPTIQQLCYSLS
SLVIFGNFLFILGSYTLVLLAVLHMPSTLGRHKAFSTCGSHLAVVSLFYGSLMIMYVSPG
LGHSAGIQKVATLFYAMVTPLFNPLIYSLRNKEIKAALRKVLGRCYMTQDVLCDCSRSV