Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR11H6 Olfactory Receptor

Gene Symbol OR11H6
Organism Dog
Family 11
Subfamily H
Pseudo No
Location chr15:17,592,400-17,593,400 (+)
Aliases cOR11H8, cOR11G4

Sequence information


Nucleotide sequence

ATGCTCATCATTATTCACTCATTGGTTATCTCTGCTTCTCTAACAGCTTTGGAATCCCAG
AACACAACAATGCGTTTTGTGTCTGAGTTTGTCCTCCTGGGTTTCCCTGGTCAAAGGGAG
ATGCAGAACTTTTTCTTCTCATTCATCCTGGTGATCTATCTCCTCACCCTGCTGGGGAAT
GGGATTATTGTCTGCATAGTGAAATGGGACAAGCAGCTTCACACACCCATGTACATCTTC
TTGGGAAACTTTGCCTTCCTAGAGATCTGGTACACCTCCTCCACTGTCCCAAGTATGCTG
GTCAACATCCTTTCCGAGACCAAGACCATCTCCTTCACTGGGTGCTTCCTTCAATTCTAC
TTCTTTTTCTCACTGGGTACAACAGAGTGTTTCTTCTTATCAGTCATGGCTTATGATCGG
TACCTCGCCATCTGTCGCCCACTCCATTACCCCTCCATCATGACTGGGAAGCTCTGTGTG
GCCCTGGTCTGTGTTTGCTGGGTGAGTGGATTTCTCTGCTATCCAGTCCCCATTGTCCTC
ATCTCCCAACTTCCATTCTGTGGACCCAACATCATTGATCACTTTGTGTGTGACCCAGGC
CCACTGTTCGCACTGGCCTGCATCCCTGCTCCTTCCACTGAGCTTCTCTGTTACACCTTC
AATTCACTGATTATCTTCGGGCCCTTCCTCTTCATCCTGGGATCTTACACCCTGGTTCTC
AGAGCTGTGCTTCGCATTCCTTCTGGTGCAGGTCGAACTAAAGCATTCTCCACGTGTGGG
TCCCATCTAATGGTGGTGTCTCTATTCTATGGAACCCTTATGGTGATGTATGTGAGCCCG
ACATCAGGGAATCCGACGGGAATGCAAAAGATCATCACTCTGGTATACTCGGCAGTGACT
CCACTCTTAAACCCCCTTATCTATAGTCTCCGAAACAAAGACATGAAAGATGCCCTAAAG
AAAGTCCTAGGATTAAGAAGTAACCAAAAC


Conceptual translation

MLIIIHSLVISASLTALESQNTTMRFVSEFVLLGFPGQREMQNFFFSFILVIYLLTLLGN
GIIVCIVKWDKQLHTPMYIFLGNFAFLEIWYTSSTVPSMLVNILSETKTISFTGCFLQFY
FFFSLGTTECFFLSVMAYDRYLAICRPLHYPSIMTGKLCVALVCVCWVSGFLCYPVPIVL
ISQLPFCGPNIIDHFVCDPGPLFALACIPAPSTELLCYTFNSLIIFGPFLFILGSYTLVL
RAVLRIPSGAGRTKAFSTCGSHLMVVSLFYGTLMVMYVSPTSGNPTGMQKIITLVYSAVT
PLLNPLIYSLRNKDMKDALKKVLGLRSNQN