Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR11I1 Olfactory Receptor

Gene Symbol OR11I1
Organism Dog
Family 11
Subfamily I
Pseudo No
Location chr6:41,127,800-41,128,800 (-)
Aliases cOR11I3

Sequence information


Nucleotide sequence

ATGGTGATCCTGCCCTGGGAAAACCAAACAACCATAGTGGAATTTATGCTTCAAGGATTC
TCCTCTATCCGACAGCTAAATATCTTTCTCTTTATAATGTTTTTAGTTTTCTATGTCTTA
GTCATTTCTGGCAACATCCTCATTGTTCTGCTAGTTTTGTTCATCCATCACCTCCACACC
CCCATGTACTTCTTCCTGGTGAACTTGTCCTTTCTAGAGATCTGCTATACCTCCAATATT
GTCCCCAAGATGTTACTGATCACCATAGCTGAACAGAGGACTATCTCTGTTGCTGGGTGC
ATGGCACAGTTCTACTTCTTTGGATCTCTGGCTGCAACAGAGTGTCTTCTGCTGGCTGTG
ATGTCCTATGACCGATACCTGGCCATCTGCCAACCTCTCCACTATCCCATCCTCATGACT
GGCCCCCTTTGCATTAGGCTAGCTGCCAGCTCTTGGCTCTGCTGCTTCCTTCTTACAGCA
ATCACTATGGTCTTACTATCTAGATTGACCTTCTGTGGACCTAATGAAATTGATCACTTC
TTCTGTGACTTCACCCCTCTCGTCCACCTCTCCTGCACAGACACCTCACTGACGGAGACC
ATCGCCTTTGCCACCTCTTCGGCAGTAACTCTGGTTCCGTTTCTCCTCATCGCAGCCTCC
TACTCCTGCATTCTTATTGCTATCCTAAGAATTCCACCTGGCACAGGTCGGAGAAAGGCC
TTCTCCACCTGCTCCTCCCACCTCACCGTGGTCACAGTGTTTTATGGGACACTGATTGCC
ACGTATCTTGTGCCTTCAGCCAATTCTTCACAACTCTTGCGCAAAGGATTCTCTCTTCTC
TATACCATCCTGACACCCATGTTCAACCCCATCATCTACAGCCTAAGAAACAGAGACATC
CATGAAGCCCTGAAGATGTGCTTGAGTAAGAAGCCAGGATTCCTCCTTAGA


Conceptual translation

MVILPWENQTTIVEFMLQGFSSIRQLNIFLFIMFLVFYVLVISGNILIVLLVLFIHHLHT
PMYFFLVNLSFLEICYTSNIVPKMLLITIAEQRTISVAGCMAQFYFFGSLAATECLLLAV
MSYDRYLAICQPLHYPILMTGPLCIRLAASSWLCCFLLTAITMVLLSRLTFCGPNEIDHF
FCDFTPLVHLSCTDTSLTETIAFATSSAVTLVPFLLIAASYSCILIAILRIPPGTGRRKA
FSTCSSHLTVVTVFYGTLIATYLVPSANSSQLLRKGFSLLYTILTPMFNPIIYSLRNRDI
HEALKMCLSKKPGFLLR