Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR13C7F Olfactory Receptor

Gene Symbol OR13C7F
Organism Dog
Family 13
Subfamily C
Pseudo No
Location chr11:52461705-52462661 (-)
Aliases cOR13C19, cOR13C19

Sequence information


Nucleotide sequence

ATGGACAGGTTCAATTGGACTTCTCCTGTGATGGGGTTCATCCTCCTGGGCCTCTCAGCC
CACCCGAAGCTGGAGAAAATGTTCTTTGTGCTCATCCTCTTGATGTACCTGGTGATCCTG
CTGGGCAACGGGGTCCTCATCCTGGTGACCATCCTTGACTCCCGCCTGCACACACCCATG
TACTTCTTCCTGGGGAACCTCTCCTTCCTGGACATCTGCTACACAACCTCCTCAGTCCCC
CTTATTCTTGACAGCTTCCTGACCCCCAGCAAAACCATACCCTTCTCAGCCTGTGCTGTG
CAGATGTTTCTCTCCTTTGCCATGGGAGCCACAGAGTGTGTGCTACTGGGCATGATGGCA
TTTGATCGCTATGTGGCCATCTGTAACCCACTTAGGTACCCTGTGGTCATGAGCAAGGCT
GCCTATGTGCCCATGGCTGCCAGCTCCTGGGCAGCTGGAAGCATGACTGCCACGGTGCAA
ACATCCTTAGCGATGCGACTGCCTTTCTGTGGGGACAACATCATCAACCACTTCACCTGT
GAGATCCTGGCAGTCCTAAAGTTGGCCTGTGCTGATATTTCCATCAATGTGATCAGTATG
GCAGTGGCTAATGTGATCTTCCTTGGCATTCCAGTTCTATTTATTTCTGTCTCTTATGTG
TTCATCATTGCTACCATCCTGAGGATCCCCTCAGCTGAGGGGAGGAAAAAGGCCTTCTCC
ACCTGCTCTGCCCACCTCACTGTAGTGGTCATCTTCTATGGAACAATCCTCTTTATGTAT
GGGAAGCCCAAATCCAAGGATCCTCAGGGGGCAGACAAGCAGGACATTTCTGACAAGCTC
ACCTCCCTCTTTTATGGGGTAGTGACCCCCATGCTCAACCCCATCATCTACAGCCTGAGG
AACAAGGACGTGAAGGCTGCTGTGAGGAATCTGGTACTTCACAAACACTTTATCCAG


Conceptual translation

MDRFNWTSPVMGFILLGLSAHPKLEKMFFVLILLMYLVILLGNGVLILVTILDSRLHTPM
YFFLGNLSFLDICYTTSSVPLILDSFLTPSKTIPFSACAVQMFLSFAMGATECVLLGMMA
FDRYVAICNPLRYPVVMSKAAYVPMAASSWAAGSMTATVQTSLAMRLPFCGDNIINHFTC
EILAVLKLACADISINVISMAVANVIFLGIPVLFISVSYVFIIATILRIPSAEGRKKAFS
TCSAHLTVVVIFYGTILFMYGKPKSKDPQGADKQDISDKLTSLFYGVVTPMLNPIIYSLR
NKDVKAAVRNLVLHKHFIQ