Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR13H2P Olfactory Receptor

Gene Symbol OR13H2P
Organism Dog
Family 13
Subfamily H
Pseudo Yes
Location chrX:102640012-102640936 (+)
Aliases cOR13H2P, cOR13H2P

Sequence information


Nucleotide sequence

ATGGCCATAGATAATGCTACAACAGTGTTTGAGTTTCTGTTTATTGGAATCTCTAACTAT
CCTGAGTGAAGAATCACATTTTTCACATTGGTGCTGATAACTTACCTGAGCACATTGCTG
GGGAATGGACTTAATCATCTTTCTTATCTACTTTGACCTCCACCTCCACACTCCAATGTA
CTTCTTCCTTACTAATCTGTCTTTCTTAGATCTTTGCTATGGAAGCACTTCCATGCCCCA
GGCCTTAGTGCATTGTTTCTCTACCCATCCCTACCTCTCTTACCCAGGATGTTTGACCCA
AATGAGTGTCTCCTTGGTCTTGGCCACAGCAGAGTGCCTCCTACTGGCTGTCATGGCCTA
TGACCATATGGCTGCTATCAGCAATCCCCTGCGCTATTCTGTGATCATGAATGCCCCAGT
GTGTGTCTGGCTGGCTACTACTTTGTGGGGGGAATCACTTGTGCTCACTGCCATGCTCGT
CTTATCCCTGCAGCTTCACTTCTATGGAGTTAATATCATCAACCATTTTGTCTGTGAAAT
TCTTTCCCTCCTTAAGCTGGCCTGTTCTGATACTAATCTCAATGAGCTTATGATCTCCAC
CACAGGTATCTTCACTCTGCTCCTACCCTTTGGATTTGTTCTTCTTTCCTATGCCCAAAT
TGCCACTACTGTCTTAGAGATTCTCTCAGCCCAGGGTAGGCTCAAGGCCTTTTCCACCTG
TGGCTCTCATTTGACTGTGGTGACAGTCTTCTAAGGGGCAACCATTTCCATGTATATGAA
ACCTCAGTCCAAGTCATCTGCTGAGCAGAACAAGTTTATTTCAGTGTTTTATGGGGCTTT
GACACCCATGTTGAACCCCTTAATATATAGCCTGAGGAACAAGGATGTTAGAGGGGCAAT
GAGGAAAGTTATTGCAAAAAGGACA


Conceptual translation

MAIDNATTVFEFLFIGISNYPE*RITFFTLVLITYLSTLLGNGL\IFLIYFDLHLHTPM
YFFLTNLSFLDLCYGSTSMPQALVHCFSTHPYLSYPGCLTQMSVSLVLATAECLLLAVMA
YDHMAAISNPLRYSVIMNAPVCVWLATTLWGESLVLTAMLVLSLQLHFYGVNIINHFVCE
ILSLLKLACSDTNLNELMISTTGIFTLLLPFGFVLLSYAQIATTVLEILSAQGRLKAFST
CGSHLTVVTVF*GATISMYMKPQSKSSAEQNKFISVFYGALTPMLNPLIYSLRNKDVRGA
MRKVIAKRT