Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1A1 Olfactory Receptor

Gene Symbol OR1A1
Organism Dog
Family 1
Subfamily A
Pseudo No
Location chr9:47,120,600-47,121,600 (-)
Aliases cOR1A3

Sequence information


Nucleotide sequence

ATGAGGGAAGACAACCAATCCTCTACCCTGGAATTCATCCTCCTGGGAGTTACTGGTCAG
CAGGACCAGGAAGACTTTTTCTTTACCCTCTTCCTGTTCATTTACCCCATCACGTTGATT
GGAAACTTGCTCATCATCTTGGCCATTCGCTCTGATGTTCGCCTTCACAATCCCATGTAC
TTTTTCCTTGCCAACCTCTCCTTTGTTGACATCCTCTTCTCTTCTGTAACCATCCCTAAA
ATGCTGGCAAATCATCTCTTGCACAGCAAAGCCATCTCCTTTGGTGGATGCCTAACACAG
TTGTATTTTATGATTGCCTTGGGCAACACAGATAGCTATATCTTGGCTGCAATGGCATAT
GATCGTGCGGTGGCCATCAGTCGCCCACTTCATTACACAACAATCATGAGCCCATGGACT
TGTGTCCTCCTAGTTGTTGGGTCTTGGGTGGTTGGTAATGCCAATGCCCTCCCCCACACT
CTGCTCACAGCCAGGCTGTCCTTCTGTGGCAACAAGGAAGTAGCCAACTTCTACTGTGAT
ATTACCCCTTTGCTTAAGCTGTCCTGTTCTGACATCCTCTTTAATGTGAGGATGATGTAC
CTAGGGGTTGGTGTCTTCTCTGTGCCATTACTATGCATCATTATCTCCTATGTCCAGGTC
TTTTCCACAGTCTTACGGGTCCCATCTACCAAAGGTGTGCTCAAGGCCTTCTCTACCTGT
GGTTCCCACCTCACAGTTGTTTTTCTGTATTATGGGACAGTCATGGGCATGTATTTCCGC
CCTCTGTCTAGTTACAGCCTAAAGGATGCAATCATAACTGTTATGTACATGGCAGTGACC
CCAATGTTAAATCCTTTCATTTATAGTTTGAGAAACCGAGACATGAAGGCTGCCCTGGGG
ATACTATTATGCAAGAGAATCTCCTTA


Conceptual translation

MREDNQSSTLEFILLGVTGQQDQEDFFFTLFLFIYPITLIGNLLIILAIRSDVRLHNPMY
FFLANLSFVDILFSSVTIPKMLANHLLHSKAISFGGCLTQLYFMIALGNTDSYILAAMAY
DRAVAISRPLHYTTIMSPWTCVLLVVGSWVVGNANALPHTLLTARLSFCGNKEVANFYCD
ITPLLKLSCSDILFNVRMMYLGVGVFSVPLLCIIISYVQVFSTVLRVPSTKGVLKAFSTC
GSHLTVVFLYYGTVMGMYFRPLSSYSLKDAIITVMYMAVTPMLNPFIYSLRNRDMKAALG
ILLCKRISL