Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1D3P Olfactory Receptor

Gene Symbol OR1D3P
Organism Dog
Family 1
Subfamily D
Pseudo Yes
Location chr9:47,180,900-47,181,800 (+)
Aliases cOR1D11

Sequence information


Nucleotide sequence

ATGGATGGAGTCAACAATAGTGGAGTCTCTGAGTTCCTGCTCCTGGGGATTTCTGAGAGT
CCTGAGCAGCAGCGGGTCCAGTTCTGGATGTTCCTGTCCATGTACCTGGTCACAGTGGTG
GGAAATGTGCTCATCATCCTGGCCATCAGCTTTGATCCCCGCCTGCACGCTCCCATGTAC
TTCTTCCTGGCCAACCTTTCCTTCACTGACCTCTTCTTTGTCACCAATACAATACCCAAG
ATGCTGGTGAGCCTCCAGTCTCAGAACAAAGCCATCTCCTATGCAGGGTGTCTGACACAG
CTTTACTTCCTGGTCTCCTTGGTGGCCCTGGACAACCTCATCCTGGCCACAATGGCATAT
GACCGCTATGTGGCCATCTGCCGCCCCCTCCACTACACCACAGCCATGAGCCCTGGACTC
TGTATTTTGCTCCTCGCCTTGTGTTGGGCACTTTCTGCCCTCTATGGCCTCACCCACACC
CTCCTCATGACCAGAGTGACATTTTGTGGATCCCGGAAGATCCACTACATCTTCTGTGAG
ATGTATGTTCTGCTGAGGCTCGCATGTTCCAACACTCAAGTCAATCACACAGTGCTGATT
GCCACAGGCTGCTTTATCTTCCTCACCCCCTTAGGGTTCATGATAATGTCCTATGTCTGA
ATTGTCAGAGCCATCCTCCGAATACCCTCAGCCACTGGGAAGTACAAAGCCTTCTCCACC
TGTGCCTCCCATTTGGCTGTAGTCTCCCTCTTCTATGGGACACTTGGTATGGTATATCTG
CAGCCCCTCCAGACCTACTCCATGAAGGACTCAGTAGCCACAGTGATGTATGCTGTGGTG
ACCCCCATGATGAACCCTTTCATCTACAGCCTGAGGAACAAGGACATGCATGGGGCTCTG
GGAAGACTGTTCCTAGGGAAAGCCTTCCAGAGGTTGACA


Conceptual translation

MDGVNNSGVSEFLLLGISESPEQQRVQFWMFLSMYLVTVVGNVLIILAISFDPRLHAPMY
FFLANLSFTDLFFVTNTIPKMLVSLQSQNKAISYAGCLTQLYFLVSLVALDNLILATMAY
DRYVAICRPLHYTTAMSPGLCILLLALCWALSALYGLTHTLLMTRVTFCGSRKIHYIFCE
MYVLLRLACSNTQVNHTVLIATGCFIFLTPLGFMIMSYV*IVRAILRIPSATGKYKAFST
CASHLAVVSLFYGTLGMVYLQPLQTYSMKDSVATVMYAVVTPMMNPFIYSLRNKDMHGAL
GRLFLGKAFQRLT