Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1J6P Olfactory Receptor

Gene Symbol OR1J6P
Organism Dog
Family 1
Subfamily J
Pseudo Yes
Location chr9:60087552-60088507 (-)
Aliases cOR1J6P, cOR1J6P

Sequence information


Nucleotide sequence

ATGAGGAGGGAGAACCAGAGCAGCGTGTTAGAGTTTCTCCTCCTGGGGCTCCCCATCCAG
CCAGAGCAGCAGCGCATGTTCTTTGCCCTGTTCCTGGGCATGTACCTGACCACGGTGCTT
GGGAATCTGCTCACCATCCTACTCATCAGACTGGACTCTCACCTCCACACCCCCATGTAC
TTCTTCCTTAGCCACTTGGCCTTCTCTGATGTCTCTTTCTCATCTGTCACTGTCCCAACG
ATGCTGATGAACATGCAGACTCGGCACTTAACCGTCTCCTATGCGGGGTGCATTTCCCAG
ATGTATTTTTTCATACTTTTTGTTTGTCTTGACAATTTTCTTCTTGCAGCGACAGCATAT
GACAGGTATGTGGCCATCTGTCAGCCACTCCACTACACCACTGTCATGAGGGAGGAGCTG
TGTATCTTACTGGTGGCTGGATCCTGGTTCTTCTCGTGTGCCCATGCCCTGTTGCATACT
CTCCTTCTGTCACGCCTGTCCTTCTGTGCTGACAATACCATCCCTCATTTCTTTTGTGAT
CTCACTGCCCTCTTGAAGTTAGCCTGCTCAGATACTTCCCTCAATGAGCTAGTTATCTTC
ACTGAGAGGGGAGTGTTTGCCTTCCTGTCATTTTGTGCTATTTTGGCCTCCTATATCTAT
GTTGGGGCCACCATCCTGAGAGTCCCTCCATCAAGAGGATCTGCAAAGCCTTGTCTACCT
GTGGCTCCCACCTCCTTGTGGTGTTGTACTATGGGACTCTTGCAATGATTTACTTCATTC
CTTCATCAAACAGTTCCAAGGTCAAAGACATTATTGCTTCAGTTTTGTATACAGTGGTGA
TACCCATGTTAAACCCTTTTATGTATGGCCTGAGGAACAGGGACATGAAATAAGCTCTGA
GGACACTTTACAGGAGGAAAATTTTTTCTTACCAAGTGAATTTTACTCATGTTCTT


Conceptual translation

MRRENQSSVLEFLLLGLPIQPEQQRMFFALFLGMYLTTVLGNLLTILLIRLDSHLHTPMY
FFLSHLAFSDVSFSSVTVPTMLMNMQTRHLTVSYAGCISQMYFFILFVCLDNFLLAATAY
DRYVAICQPLHYTTVMREELCILLVAGSWFFSCAHALLHTLLLSRLSFCADNTIPHFFCD
LTALLKLACSDTSLNELVIFTERGVFAFLSFCAILASYIYVGATILRVPPSR/ICKALS
TCGSHLLVVLYYGTLAMIYFIPSSNSSKVKDIIASVLYTVVIPMLNPFMYGLRNRDMK*A
LRTLYRRKIFSYQVNFTHVL