Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1L8 Olfactory Receptor

Gene Symbol OR1L8
Organism Dog
Family 1
Subfamily L
Pseudo No
Location chr9:60118039-60118980 (+)
Aliases cOR1L8, cOR1L8

Sequence information


Nucleotide sequence

ATGGCAAGGGTCAACCAAACCAGCAGTGTCTCTGAGTTCATTCTCCTGGGACTCTCCTCC
CAGCCTGAGGACCAGAAGCCACTCTTTATCCTCTTCCTCACCATGTACCTGATCACCATA
ATAGGGAACCTACTCATCATCCTGGCCATCCATTCTGATCCCCAGCTCCAGACCCCCATG
TATTTCTTCTTGAGTTTCCTGTCCTTCACTGATATTTGCTTTACAACAACTGTTGTCCCC
AGGATGCTAGTGAGCTTCCTTTCTAAGAAGACCATCTCCTATGCTGGGTGTCTGACACAG
ATGTATTTCATTTATGCTCTGGGCAACACCGACAGCTGCCTTCTGGCAGTCATGGCCTTT
GACCGCTATGTGGCTATCTGTGACCCCTTCCACTACGTCACCACCATGAACCGCCGCTGC
TGTGTCCTGCTGGTGGCCTTTTCCTGCTCACTTCCCCACTTCCACTCACTCGTACACACA
CTGCTACTGAACAGCCTCACTTTCTGTGACTCCAATGTCATCCACCACTTCCTCTGTGAC
CTCAGTCCCTTGATGAAATTGTCCTGTTCCTCCACATTTGTCAATGAAGTTGTGATAATA
TCAGAAGGTTCTGTTGTTTTGGTGACTCCATTTCTGTGCATCACTCTCTCTTATGTACGA
ATTCTCATCGCAGTTCTTAAGATCCCTTCAGCTGCTGGGAAACGCAAAGCCTTCTCCACC
TGTGGCTCTCACCTCACCGTGGTCACACTCTTTTATGGAAGCATCTTCTATGTCTATTTA
CAGCCCCTGTCCACCTACAGTGCCAGGGACCACATAGCAACAATTGTCTACACAGTTCTT
TCCTCCATGCTAAACCCTTTTATCTACAGCCTGAGAAACAAAGACCTGAAACAGAGCCTA
AGGAAGCTGATGGGCAGGTGGAATTCTCAAGCAACACCCTCT


Conceptual translation

MARVNQTSSVSEFILLGLSSQPEDQKPLFILFLTMYLITIIGNLLIILAIHSDPQLQTPM
YFFLSFLSFTDICFTTTVVPRMLVSFLSKKTISYAGCLTQMYFIYALGNTDSCLLAVMAF
DRYVAICDPFHYVTTMNRRCCVLLVAFSCSLPHFHSLVHTLLLNSLTFCDSNVIHHFLCD
LSPLMKLSCSSTFVNEVVIISEGSVVLVTPFLCITLSYVRILIAVLKIPSAAGKRKAFST
CGSHLTVVTLFYGSIFYVYLQPLSTYSARDHIATIVYTVLSSMLNPFIYSLRNKDLKQSL
RKLMGRWNSQATPS