Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR1M1B Olfactory Receptor

Gene Symbol OR1M1B
Organism Dog
Family 1
Subfamily M
Pseudo No
Location chr20:51719180-51720118 (+)
Aliases cOR1M2, cOR1M2

Sequence information


Nucleotide sequence

ATGGAACCAAGGAACCAAACTAGTGCATCCGAATTCATCCTCCTGGGGCTTTCAGAAAAT
CCAGAGCAGGAGACCCTCCTCTTTGCTCTGTTTCTCTGCATGTATGTGGTCACAGTAGTG
GGGAATCTGCTCATCATCCTGGCCATCAGCTCAGACTCCTACCTCCACACTCCCATGTAC
TTCTTCCTGGCCAATCTCTCCTTGGTTGATTTCTGTCTGGCCACCGATACAGTCCCCAAG
ATGCTAGTGAACATCCAAATCAGGAGCAAGTCAATCTCCTACGCCTGTTGCCTGACCCAG
ATGTACTTTTTCCATTTCTTTGGCATTATGGACAGTGTCTTAATTGCTGTGATGGCTTAT
GACCGGTTTGTGGCTATATGTCATCCCTTACACTATACTACCATCATGAGCCCACGCCTC
TGTGGCCTGCTGGCTGGTGGTCCATGGGTATTTTCCTGCTTCATTTCCCTCACTCATATC
CTCTTGATGGCCCGTCTGGTTTTCTGTGGGAGCAATGAGTTGCCCCACTACTTCTGTGAC
CTCACTCCTCTTCTCAGGCTTTCTTGCACTGATACATCTGTGAACAAGATCTTTGTGCTC
ATTGTGGCTGGGATGGTGATAGCCACACCATTCATCTGCATCCTGGCCTCCTATGCTCGC
ATCATTGTGGCCATCATGAAGGTCCCTTCTGCAGGCGGCAGGAAGAAAGCCTTTTCCACC
TGCAGCTCCCATCTGTCTGTGGTTGCTCTCTTCTATGGGACCACCATTGGGGTCTATTTG
TGTCCTTCCTCTGTGCGCACAGCTGTGAAGGAGAAAGCCTCTGCTGTGATGTACACTGCG
GTCACCCCCATGCTGAACCCCTTTATCTATAGCCTGAGGAACAGAGATCTTAAGGGGGCC
CTGAGGAAGCTTGTCAACAGAAAAATCACTTCATCTTCC


Conceptual translation

MEPRNQTSASEFILLGLSENPEQETLLFALFLCMYVVTVVGNLLIILAISSDSYLHTPMY
FFLANLSLVDFCLATDTVPKMLVNIQIRSKSISYACCLTQMYFFHFFGIMDSVLIAVMAY
DRFVAICHPLHYTTIMSPRLCGLLAGGPWVFSCFISLTHILLMARLVFCGSNELPHYFCD
LTPLLRLSCTDTSVNKIFVLIVAGMVIATPFICILASYARIIVAIMKVPSAGGRKKAFST
CSSHLSVVALFYGTTIGVYLCPSSVRTAVKEKASAVMYTAVTPMLNPFIYSLRNRDLKGA
LRKLVNRKITSSS