Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2A25 Olfactory Receptor

Gene Symbol OR2A25
Organism Dog
Family 2
Subfamily A
Pseudo No
Location chr16:5826285-5827214 (-)
Aliases cOR2A43, cOR2A43

Sequence information


Nucleotide sequence

ATGGCGGGAAATCAGACCTCTGTCACAGAGTTCATCCTATTGGGCTTTCCCCTCAGCCCA
GAGATTCAGATGGTTCTCTTTGGGCTCTTCACCCTGTTCTACGCCTTCACCCTGCTGGGG
AATGGGCTCATCCTGGGGCTCATCTCACTGGACCCCAGACTGCACACCCCCATGTACTTC
TTCCTCTCCCACCTGGCCATCGTCGACATAGCCTATGCCTGCAACACGGTGCCCCAGATG
CTGGTGAACCTCCTGAGGCCAGACAAGCCCATCTCCTTTGCTGGCTGCTTGACGCAGACC
TTTCTTTTCTTGACCTTTGCTCATACTGAGTGTCTTCTCCTGGTGGTGATGTCCTATGAC
CGGTACGTGGCCATCAGCCACCCCCTCCACTATTCTGTCATCATGAGCTGGAGAGTCTGC
ATCACCCTGGCATTGACTGCCTGGATTTTAGGAGTGCTCCTGGCCCTAGTACATCTAGGG
TTACTCATACCATTGCCTTTCTGTGGACCCCAGAAAGTCAACCACTTTTTCTGTGAAATT
ATAGCTGTCCTCAAACTTGCCTGTGCAGATACCCACGTTAATGAGATTATGGTATTGACT
GGGGCCGTGTCTGTGCTGGTAGGGCCTTTTACCTCAATTGTGATATCATACATTCATATT
CTACGTGCCATCCTGAAGATTCAGTCAGGGGAGGGGCGCCAGAAAGCCTTCTCCACCTGC
TCATCCCATCTCTGTGTGGTTGGACTCTTTTATGGCACAGCCATTATAATGTATGTTGGG
CCCAGATATGGGAACCCCAAGGAGCAAAAGAAATACCTGCTCCTGTTTCACAGCCTTTTC
AATCCCATGCTCAATCCCCTTATCTATAGTCTGAGGAACAAAGAAGTCAAAGCTGCTCTG
AAGAGGATTCTTGAAAAAGAAAGAACTTCA


Conceptual translation

MAGNQTSVTEFILLGFPLSPEIQMVLFGLFTLFYAFTLLGNGLILGLISLDPRLHTPMYF
FLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLTFAHTECLLLVVMSYD
RYVAISHPLHYSVIMSWRVCITLALTAWILGVLLALVHLGLLIPLPFCGPQKVNHFFCEI
IAVLKLACADTHVNEIMVLTGAVSVLVGPFTSIVISYIHILRAILKIQSGEGRQKAFSTC
SSHLCVVGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNKEVKAAL
KRILEKERTS