Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2A7 Olfactory Receptor

Gene Symbol OR2A7
Organism Dog
Family 2
Subfamily A
Pseudo No
Location chr16:5725754-5726683 (-)
Aliases cOR2A7P, cOR2A7P

Sequence information


Nucleotide sequence

ATGGGAGACAATATGACATATATCACAGAGTTCACCCTACTGGGATTTCCTCTTGGCCCA
AGGATTCAGATGGTTCTCTTTGGGCTCTTCACCCTGTTCTATGCCTTCACCCTGCTGGGG
AATGGGCTCATCCTGGGGCTCATCTCACTGGACCCCAGACTGCACACCCCCATGTACTTC
TTCCTCTCCCACCTGGCCATCGTCGACATAGCCTATGCCTGCAACACGGTGCCCCAGATG
CTGGTGAACCTCCTGAGGCCAGACAAGCCCATCTCCTTTGCTGGCTGCCTGACGCAGACC
TTTCTCTTTCTGACCTTTGCTGTCACAGAATGTCTTCTCCTGGTGGTGATGTCCTATGAC
CGGTATGTGGCCATTTGCCACCCCCTCCGCTATTCTGTGATCATGAGCTGGAGAGTCTGC
ATCACCCTGGTGCTGACTTCTTGGACCATTGGAGTCCTTCTGTCTTTGGTTCATCTCATG
TTACTTCTCCCCTTACCCTTCTGTAGATTCCAGAAAATCAATCACTTTTTCTGTGAAATC
ATGGCTGTTCTCAAACTTGTCTGTGCAGATACCCACATCAATGAGATTATGGTATTGGCT
GGAGCAATTTCTGTGCTAGTGGGACCCTTCTCCTCAATTGTAATCTCCTATATGTGCATT
TTCTGTGCCATCCTTAGAATCCAGTCTGGAGAAGGTCAAAGAAAAGCCTTCTCCACCTGC
TCATCTCATCTCTGTGTGGTTGGACTCTTTTACGGCACAGCCATCATAATGTATGTTGGG
CCCAGATATGGGAACCCCAAGGAGCAGAAGAAATACCTGCTCCTGTTTCACAGCCTTTTC
AACCCCATGCTCAACCCCCTTATCTATAGTCTTAGGAACTTAGAAGTGAAAAATGCCTTG
AAGAGAGTGCTGGGAATACAGAGAGCTTTA


Conceptual translation

MGDNMTYITEFTLLGFPLGPRIQMVLFGLFTLFYAFTLLGNGLILGLISLDPRLHTPMYF
FLSHLAIVDIAYACNTVPQMLVNLLRPDKPISFAGCLTQTFLFLTFAVTECLLLVVMSYD
RYVAICHPLRYSVIMSWRVCITLVLTSWTIGVLLSLVHLMLLLPLPFCRFQKINHFFCEI
MAVLKLVCADTHINEIMVLAGAISVLVGPFSSIVISYMCIFCAILRIQSGEGQRKAFSTC
SSHLCVVGLFYGTAIIMYVGPRYGNPKEQKKYLLLFHSLFNPMLNPLIYSLRNLEVKNAL
KRVLGIQRAL