Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2B2 Olfactory Receptor

Gene Symbol OR2B2
Organism Dog
Family 2
Subfamily B
Pseudo No
Location chr35:25078791-25079729 (-)
Aliases cOR2B2, cOR2B2

Sequence information


Nucleotide sequence

ATGAACCAGGTAAATGAAAGCATCCCACAGGAGTTCATCCTCTTAGGTTTCTCAGATCGA
CCATGGCTAGAGCTCCCACTCTTTGTGGTCTTCCTGGTTTCCTATATCTTGACTATCTTT
GGCAATCTGACAATAATTCTTGTGTCTTATCTGGACCCCAAACTCCATACCCCTATGTAC
TTTTTTCTTACCAATCTGTCGCTCCTGGACCTTTGCTATACCACAAGTACAGTTCCACAG
ATGCTGGTAAACATATGCAGCACCAGGAAGGTGATTAGTTATGGTGGCTGTGTGGCCCAG
CTCTTCATTTTCCTGGCCTTGGGTTCCACTGAATGTCTTCTCTTGGCTGTCATGTCTTTT
GATAGGTTTGTAGCTATTTGTCGGCCTCTCTATTACTCAGTTATCATGCACCAAAGGCTG
TGCCTCCAGCTGGCGGCTGCATCCTGGCTCAGTGGCTTTGGCAACTCAGTGTTGCAATCC
ACCTGGACCCTTCAGATGCCTCTCTGTGGCCATAGAGAAGTAGATCACTTCTTTTGTGAA
GTCCCTGCTCTGCTCAAGTTGTCCTGTGTAGACACAACAGCAAACGAGGCTGAACTATTC
TTTATCAGTGTGCTGTTCCTTCTAATACCTGTAACGTTCATCCTTATATCTTATGGTTTT
ATTGTCCAAGCAGTGTTGAGGATTCAGTCAGCCAAAGGCCGGCGAAAAGCGTTTGGCACC
TGTGGCTCCCATCTAATTGTGGTGTCACTGTTTTATGGCACTGCTATCTACATGTATCTG
CAACCACCATCACCCAACTCAAAGGACCGGGGGAAGATGGTGTCCCTCTTCTATGGAATC
ATCACACCCATGTTGAACCCCCTTATATACACACTAAGAAACAAAGATGTAAAGGGAGCA
TTTAGGAGGTTGATTCTGAAGATCTTCTTAATCAAGAAA


Conceptual translation

MNQVNESIPQEFILLGFSDRPWLELPLFVVFLVSYILTIFGNLTIILVSYLDPKLHTPMY
FFLTNLSLLDLCYTTSTVPQMLVNICSTRKVISYGGCVAQLFIFLALGSTECLLLAVMSF
DRFVAICRPLYYSVIMHQRLCLQLAAASWLSGFGNSVLQSTWTLQMPLCGHREVDHFFCE
VPALLKLSCVDTTANEAELFFISVLFLLIPVTFILISYGFIVQAVLRIQSAKGRRKAFGT
CGSHLIVVSLFYGTAIYMYLQPPSPNSKDRGKMVSLFYGIITPMLNPLIYTLRNKDVKGA
FRRLILKIFLIKK