Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2F1 Olfactory Receptor

Gene Symbol OR2F1
Organism Dog
Family 2
Subfamily F
Pseudo No
Location chr16:5966899-5967849 (-)
Aliases cOR2F4P, cOR2F4P

Sequence information


Nucleotide sequence

ATGGGAACAGGTAACCAGACTTGGGTGAGAGAGTTTGTTCTCCTTGGCCTGTCCAGTGAC
TGGGACACAGAGGTGTCCCTCTTTGTCCTGTTCTTGATCACATACATGGTGACAGTGCTG
GGAAACTTCCTCATCATTCTTCTCATCAGACTGGACAGCCGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTCTCCCTCGTTGACGTCTCTTATGCCACAAGCATCATTCCTCAG
ATGTTGGCACATCTTCTTGCAGCCCATAAAGCAATCCCATTTGTGAGCTGTGCCGCCCAG
TTATTCTTCTCCTTGGGCTTGGGTGGGATTGAGTTTGTTCTACTGGCAGTGATGGCCTAT
GACCGCTATGTGGCCGTGTGTGACCCCCTGCGATACTCGGTCATCATGCACGGAGGGCTC
TGTACTAGGTTGGCCATCACCTCCTGGGTCAGTGGCTCTATGAACTCTCTCATGCAGACT
GTCATCACATTTCAGCTGCCCATGTGCACAAACAAGTACATTGATCACATATCCTGCGAA
CTTCTAGCTGTGGTCAGACTGGCTTGTGTGGATACTTCCTCCAACGAGATTGCAATCATG
GTTTCTAGCATTGTTCTGCTGATGACACCTTTCTGCCTGGTTCTCCTGTCCTACATCCAG
ATTATCTCCACCATCCTAAAGATCCAGTCCACAGAGGGAAGAAAGAAAGCCTTCCACACC
TGTGCCTCTCACCTCACAGTGGTTGTCCTGTGCTATGGTATGGCGATTTTCACTTACATC
CAGCCCCGCTCCAGCCCCTCTGTCCTTCAGGAGAAGTTGATCTCTCTCTTCTATTCTGTT
TTGACACCAATGCTGAACCCCATGATTTATAGTGTAAGGAATAAGGAGGTGAAGGGAGCC
TGGCAGAAACTATTAGGGCAATTAACTGGAATAACTTCAAAACTAGCAACT


Conceptual translation

MGTGNQTWVREFVLLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY
FFLTNLSLVDVSYATSIIPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAY
DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCE
LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT
CASHLTVVVLCYGMAIFTYIQPRSSPSVLQEKLISLFYSVLTPMLNPMIYSVRNKEVKGA
WQKLLGQLTGITSKLAT