Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2F1C Olfactory Receptor

Gene Symbol OR2F1C
Organism Dog
Family 2
Subfamily F
Pseudo No
Location chr16:5992679-5993767 (-)
Aliases cOR13M1P, cOR13M1P

Sequence information


Nucleotide sequence

ATGATCAGAAGCATCTGGCTAAGGCTGAAGGTCATATGCAATATGCATTCTTTTAAGAAG
TTATTCTTATGGTTCTTTAATTCAATAGTTTCTACTATTTCTGTCTTCTTCTGCAGATTA
ATAATCATATGTTTTTTAATGGACACAGAAAACCAGACTTGGGTGAGAGAGTTTATTCTC
CTTGGCTTGTCCAGTGACTGGGACACACAGGTCTCCCTCTTTGTCCTCTTCTTGATCATG
TACATGGTGACAGTGCTGGGAAACTTCCTCATCATTCTTCTCATCAGACTGGACAGCCGA
CTCCACACTCCCATGTATTTCTTTCTCACCAACCTCTCCTTCGTTGACGTCTCTTATGCC
ACAAGCATTGTTCCTCAGATGTTGGCACATCTTCTTGCAGCCCATAAAGCAATCCCATTT
GTGAGCTGTGCCGCCCAGTTATTCTTCTCCCTGGGCTTGGGTGGGATTGAGTTTGTTCTA
CTGGCAGTGATGGCCTATGACCGCTATGTGGCCGTGTGTGACCCCCTGCGATACTCGGTC
ATCATGCACGGAGGGCTCTGTACTAGGTTGGCCATCACCTCCTGGGTCAGTGGCTCTATG
AACTCTCTCATGCAGACTGTCATCACATTTCAGCTGCCCATGTGCACAAATAAGTACATT
GATCACATATCATGTGAAATCCTAGCTGTAATCAGGCTGGCCTGTGTAGACATCTCCTCC
AACGAGATTGCAATCATGGTTTCTAGCATTGTTCTGCTGATGACACCTTTCTTCCTGGTT
CTCCTGTCCTACATCCAGATCATCTCCACCATCCTAAAGATCCAGTCCACAGAGGGAAGA
AAGAAAGCCTTCCACACCTGTGCCTCTCACCTCACAGTGGTTGTCCTGTGCTATGGCATG
ACCATCTTCACTTACATCCAGCCCCGCTCCAGCCCCTCTGTCCTTCAGGAGAAGTTGATT
TCTCTCTTCTATGCCATTTTGATGCCTGTGCTGAACCCCATGATTTATAGTGTAAGGAAT
AAGGAGGTGAAGGGAGCCTGGCAGAAACTATTAGGGCAATTATCTGGAATAACGTCAAAA
CTGGCAACT


Conceptual translation

MIRSIWLRLKVICNMHSFKKLFLWFFNSIVSTISVFFCRLIIICFLMDTENQTWVREFIL
LGLSSDWDTQVSLFVLFLIMYMVTVLGNFLIILLIRLDSRLHTPMYFFLTNLSFVDVSYA
TSIVPQMLAHLLAAHKAIPFVSCAAQLFFSLGLGGIEFVLLAVMAYDRYVAVCDPLRYSV
IMHGGLCTRLAITSWVSGSMNSLMQTVITFQLPMCTNKYIDHISCEILAVIRLACVDISS
NEIAIMVSSIVLLMTPFFLVLLSYIQIISTILKIQSTEGRKKAFHTCASHLTVVVLCYGM
TIFTYIQPRSSPSVLQEKLISLFYAILMPVLNPMIYSVRNKEVKGAWQKLLGQLSGITSK
LAT