Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2F1D Olfactory Receptor

Gene Symbol OR2F1D
Organism Dog
Family 2
Subfamily F
Pseudo No
Location chr16:*************** (-)
Aliases cOR2F3, cOR2F3, cOR13M3

Sequence information


Nucleotide sequence

ATGTACTCATTAAAATGGTTCTTTGACTCAACAGCTTCTGTTATCTCCAACTGTTTGCAG
ATTAATGGTTCTCACATTTTTTTAATGGGAACAAATAACCAGACATGGATGAGAGAATTT
ATTCTCCTTGGCTTGTCCAGTGACTGGGACACACAGGTCTCCCTCTTTGTCCTGCTCTTA
GTCATGTACTTGGTGACAGTGCTGGGAAACTTCCTCATCGTTCTTCTCATCAGACTGGAC
AGCCGACTCCACACTCCCATGTATTTCTTTCTCACCAACCTCTCCTTCGTTGACGTCTCT
TATGCCACAAGCATCGTTCCTCAGATGTTGGCACATCTTCTTGCAGCCCATAAAGCAATG
CCATTTGTGAGCTGTGCCGCCCAGTTATTCTTCTCCCTGGGCTTGGGTGGGATTGAGTTT
GTTCTACTGGCAGTGATGGCCTATGACCGCTATGTGGCTGTGTGTGACCCCCTGCGATAC
TCGGTCATCATGCACGGAGGGCTCTGTACTAGGTTGGCCATCACCTCCTGGGTCAGTGGC
TCTATGAACTCTCTCATCCATACTGCCATCACATTTCAGCTGCCCATGTGCACAAACAAG
TACATTGATCACATATCATGTGAAATTTTGGCTGTGGTCAGACTGGCTTGTGTGGATACT
TCCTCCAACGAGATTGCAATCACGGTTTCGAGCATTGTTCTGCTGATGACACCTTTCTGC
CTGGTTCTCCTGTCCTACATCCAGATCATCTCCACCATCCTAAAGATCCAGTCCACAGAG
GGAAGAAAGAAAGCCTTCCACACCTGTGCCTCTCACCTCACAGTGGTTGTCCTGTGCTAT
GGTATGGCGATTTTCACTTACATCCAGCCCCGCTCCAGCCCCTCTGTCCTTCAGGAGAAG
TTGATCTCTCTCTTCTATGCTGTTTTGACACCCATGCTGAACCCCATGATTTATAGTGTA
AGGAATAAGGAGGTGAAGGGAGCCTGGCAGAAACTATTAGGGCAGTTATCTGGAATAACG
TCAAAACTGGCAACT


Conceptual translation

MYSLKWFFDSTASVISNCLQINGSHIFLMGTNNQTWMREFILLGLSSDWDTQVSLFVLLL
VMYLVTVLGNFLIVLLIRLDSRLHTPMYFFLTNLSFVDVSYATSIVPQMLAHLLAAHKAM
PFVSCAAQLFFSLGLGGIEFVLLAVMAYDRYVAVCDPLRYSVIMHGGLCTRLAITSWVSG
SMNSLIHTAITFQLPMCTNKYIDHISCEILAVVRLACVDTSSNEIAITVSSIVLLMTPFC
LVLLSYIQIISTILKIQSTEGRKKAFHTCASHLTVVVLCYGMAIFTYIQPRSSPSVLQEK
LISLFYAVLTPMLNPMIYSVRNKEVKGAWQKLLGQLSGITSKLAT