Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2F2 Olfactory Receptor

Gene Symbol OR2F2
Organism Dog
Family 2
Subfamily F
Pseudo No
Location chr16:6016467-6017417 (-)
Aliases cOR13M4, cOR13M4

Sequence information


Nucleotide sequence

ATGGAAATAGATAACCAGACATGGGCGAGAGAGTTTATTCTCCTTGGCCTGTCCAGTGAC
TGGGACACAGAGGTGTCCCTCTTTGTACTGTTCTTGATCACATACATGGTGACAGTGCTG
GGAAACTTCCTCATCATTCTTCTCATCAGACTGGACAGCCGACTCCACACTCCCATGTAT
TTCTTTCTCACCAACCTCTCCCTCGTTGACGTCTCTTATGCCACAAGCATCGTTCCTCAG
ATGTTGGCACATCTTCTTGCAGCCCATAAAGCAATCCCGTTTGTGAAATGTGCCGCCCAG
TTATTCTTCTCCCTGGGCTTGGGTGGGATTGAGTTTGTTCTACTGGCAGTGATGGCCTAT
GACCGCTATGTGGCTGTGTGTGACCCCCTGCGATACTCGGTCATCATGCACGGAGGGCTC
TGTACTAGGTTGGCCATCACCTCCTGGGTCAGTGGCTCTATGAACTCTCTCATGCAGACT
GCCATCACATTTCAGCTGCCCATGTGCACAAACAAGTACATTGATCACATATCCTGCGAA
CTCCTAGCTGTGGTCAGACTGGCTTGTGTGGATACTTCCTCCAACGAGATTGCAATCATG
GTTTCTAGCATTGTTCTGCTGATGACACCTTTCTGCCTGGTTCTCCTGTCCTACATCCAG
ATCATCTCCACCATCCTAAAGATCCAGTCCACAGAGGGAAGAAAGAAAGCCTTCCACACC
TGTGCCTCTCACCTCACAGTGGTTGTCCTGTGCTATGGCATGACCATCTTCACTTACATC
CAGCCCCATTCTGGCCCCTCTGTCCTTCAGGAGAAGTTAATCTCTCTCTTCTATGCCATT
TTAATGCCCATGCTGAACCCTATGATTTATAGTCTAAGGAATAAGGAGGTGAAGGGAGCC
TGGCAGAAACTATTAGGGCAGTTATCTGGGTTAATATCAAAACTGGCAACT


Conceptual translation

MEIDNQTWAREFILLGLSSDWDTEVSLFVLFLITYMVTVLGNFLIILLIRLDSRLHTPMY
FFLTNLSLVDVSYATSIVPQMLAHLLAAHKAIPFVKCAAQLFFSLGLGGIEFVLLAVMAY
DRYVAVCDPLRYSVIMHGGLCTRLAITSWVSGSMNSLMQTAITFQLPMCTNKYIDHISCE
LLAVVRLACVDTSSNEIAIMVSSIVLLMTPFCLVLLSYIQIISTILKIQSTEGRKKAFHT
CASHLTVVVLCYGMTIFTYIQPHSGPSVLQEKLISLFYAILMPMLNPMIYSLRNKEVKGA
WQKLLGQLSGLISKLAT