Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2H17P Olfactory Receptor

Gene Symbol OR2H17P
Organism Dog
Family 2
Subfamily H
Pseudo Yes
Location chr35:***************** (+)

Sequence information


Nucleotide sequence

ATGGGCAACCAGAACTCCCCTGGGGGCTTCCTCCTTCTGGACTTCTCTGAACACCCAGGG
CTAGAGAGAATCCTTTTTGTGGTTGTCCTCACTTCCTGTTGTGTTGTTCCTCACTCTGGT
GAGCAACACCCTCATCATCCTGCTGTCTGTGCGGGACCCAAGGCTCCACTCCTCGATGTA
CTTTTTCCTCTCCAACCTGTCCTTCTTGGACCTGCGCTTCACCACAAGCTCCGTCCCCCA
GCTGCTGGTCAACCTCTGCAGCCCAAAGACCACCAGCTTCCTTGGCTGCTCTGTTCAGCT
CTTCATCTTTCTGTTCCTGGGGACCACAGAGTGCATCCACCTGAACATGATGGCCTTTGA
CCTCTACATGGCCATATGCCAGCCTCTGCACTATACCATCATCATGCCCCCGTTGCCTGT
GCCGGCAGCTGGCGTCCATGGCCTGGGCCATCAGTCTGCTGGAGTCGGTGGTCCAGACAC
CACCCACTCTCCACCTGCCCTTGTGTCCCCACCAGCAGGGGGATGAGTTCGTGTGTGAGG
TCCCAGCTTAATCAGACTGTCTGGTGGGGACACCACCTACAACCAGATCCAGATGGCTGT
CACCAGCATCCTCATCCTGCTCATGCCCATCGGCCTCATCCTGGTCTCTTACTGTGCCAT
TGCCCAGGCAGTGCTGAGGATTAACTCAGCCAACCGGTGGAGGAAAGCATGTGGGACCTG
CTTCTCCCCTCTCGTGGTGGTCACCCTCTTCTACAGATCAGCCATCGCTGTCTACCTCCA
GCCCCAGAATGCCTATGCCCAGAAAGGGGCATAGTTCTTCTGTCTGTTCTGTGCCGTGGG
CACTGCAGCAATGAACCCTCATTTACACCCTGAAAACCAAGGAGGTAAAGAGGGCTGTCA
GAAGGTCGCTGGGGAAAGACAGGGATACATGGGAGAGC


Conceptual translation

MGNQNSPGGFLLLDFSEHPGLERILFVVVLTS\VLFLTLVSNTLIILLSVRDPRLHSSM
YFFLSNLSFLDLRFTTSSVPQLLVNLCSPKTTSFLGCSVQLFIFLFLGTTECIHLNMMAF
DLYMAICQPLHYTIIMPPL\CRQLASMAWAISLLESVVQTPPTLHLPLCPHQQGDEFVC
EVP/LIRLSGGDTTYNQIQMAVTSILILLMPIGLILVSYCAIAQAVLRINSANRWRKAC
GTCFSPLVVVTLFYRSAIAVYLQPQNAYAQKGA*FFCLFCAVGTAAMNP\YTLKTKEVK
RAVRRSLGKDRDTWES