Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2K2 Olfactory Receptor

Gene Symbol OR2K2
Organism Dog
Family 2
Subfamily K
Pseudo No
Location chr11:66,032,100-66,033,100 (-)
Aliases cOR2K2

Sequence information


Nucleotide sequence

ATGAAAGGAGGAAACCTCACCGTTTGGAGCTTTTTTTTCCTGGAGGGTTTTTCTAGATAC
CCGAAGTTAGAGATTGTTCTCTTCGTCTTCAGCCTTGTGATGTATCTGATAACTCTCTTG
GGCAACAGCACTCTGATCTTGATCACTGTCCTAGATTCACGCCTCCAAACCCCCATGTAC
TTTTTCCTTGGAAATCTGTCTTTCATGGATATCTGTTACACATCTGCATCGATTCCCACT
TTGCTGGTGAACTTGCTCTCATCCCAGAAAACCATTGTCTTTTCTGGGTGCATGGTACAG
ATGTATTTGTCCCTCGCCATGGGCTCCACAGAGTGCGTGCTCCTGGCTGTGATGGCATAT
GACCGTTACGTGGCCATTTGCCACCCACTGAGATACCCCATCATCATAAACAGGCAGGTC
TGTGTGCAGATGGCCACTGTCTCCTGGGTGACGGGGTGTGTGACCGCCCTGCTGGAAACC
AGTTTCGCCCTGCGGGTGCCCCTCTGTAGGAATCTCATCGATCACTTCACGTGTGAAATT
CTGGCCGTGCTGAAGTTAGCTTGCACGAGTTCACTGCTCATGGACATGATCATGCTGGTG
GTCAGCGTGCTCCTCCTGCCTATTCCGATGCTCTTGATTTGCATCTCTTATGTCTTCATC
CTTTCCACTATTCTGAGAATCAGCTCAGCGGAGGGAAGAAACAAAGCTTTTTCCACCTGT
GGTGCCCACCTGACTGTGGTGATCTTGTATTTTGGGGCCGCCCTGTCTATGTACCTAAAG
CCTTCTTCATCAAGTTCACAAGAAGTAGATAAGATCATCTCGCTGCTTTATGGAGTGCTG
ACCCCAATGTTGAACCCCATAATTTACAGCTTAAGGAACAAAGAAGTCAAAGGTGCCGTG
AGAAAAGTACTGGGCCAGACACCATTGTATCAAACACATGAAAATCTC


Conceptual translation

MKGGNLTVWSFFFLEGFSRYPKLEIVLFVFSLVMYLITLLGNSTLILITVLDSRLQTPMY
FFLGNLSFMDICYTSASIPTLLVNLLSSQKTIVFSGCMVQMYLSLAMGSTECVLLAVMAY
DRYVAICHPLRYPIIINRQVCVQMATVSWVTGCVTALLETSFALRVPLCRNLIDHFTCEI
LAVLKLACTSSLLMDMIMLVVSVLLLPIPMLLICISYVFILSTILRISSAEGRNKAFSTC
GAHLTVVILYFGAALSMYLKPSSSSSQEVDKIISLLYGVLTPMLNPIIYSLRNKEVKGAV
RKVLGQTPLYQTHENL