Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2L3 Olfactory Receptor

Gene Symbol OR2L3
Organism Dog
Family 2
Subfamily L
Pseudo No
Location chr14:2,072,700-2,073,630 (+)
Aliases cOR2L21

Sequence information


Nucleotide sequence

ATGGAAAATAATAACCCAAATTCTACAGATTTCTTCCTATTGGGGTTATTTCCACCATCA
AGAATTGGCCTGTTCTTCTTCATTCTCATTGTTTTCATTTTCTTAATGGCGCTTTTTGGC
AACTTGTGCATGATCATCCTCATCTTCCTAGACACCCATCTCCACACACCCATGTATTTT
CTACTTAGTCAGCTCTCCCTCATGGACCTGAGCTACATCTCCACCATTGTCCCTGAGATG
GCTTCTAATTATCTCTCTGAAAACAAGTCTATTTCTTTCATTGGTTGTGGGGTTCAGAGC
TTCTTCTTCCTGACTTTAGCAGGTGGAGAAGGATTAATATTGGCCTCAATGGCCTATGAT
CGTTATGTGGCTATTTGCTTTCCTCTCCACTATGCCATTCGTATGAGCAAAAGAGTGTGT
GTGCTGATGATAACAGGATCTTGGATAATGGGCTCAATCAACTCCTGTGCCCACACTGCA
TATGCCCTCAATATACCTTACTGTCAATCCAGAGCCATTAACCATTTCTTCTGTGATGTC
CCAGCCATGTTGACATTGGCCTGCATGGACACCTGGATCTATGAGTACACAGTGTTTGTA
AGCACCACACTCTTGATTGTGTTTCCTTTCATTGGCATTGCATGCTCCTATGGCCGGGTC
CTCCTTGCCATTTGCCGCATGCAATCAACAGAAGGGAGGAAGAAAGCCTATTCCACCTGC
AGCACTCACCTCACTGTGGTGACTTTCTACTATGCACCCTTCGCTTACACTTATCTACGC
CCGAGATCCCTCCGAAGTCCGACAGAAGACAAGGCTCTAGCTGTCTTCTACACCATCCTA
ACTCCAATGCTCAATCCCATCATCTACAGCATGAGAAATAAGGAGGTAATGGGGGCCTTG
AGACGACTGATTCAGAGGATCAGCTCTGAAAAGATG


Conceptual translation

MENNNPNSTDFFLLGLFPPSRIGLFFFILIVFIFLMALFGNLCMIILIFLDTHLHTPMYF
LLSQLSLMDLSYISTIVPEMASNYLSENKSISFIGCGVQSFFFLTLAGGEGLILASMAYD
RYVAICFPLHYAIRMSKRVCVLMITGSWIMGSINSCAHTAYALNIPYCQSRAINHFFCDV
PAMLTLACMDTWIYEYTVFVSTTLLIVFPFIGIACSYGRVLLAICRMQSTEGRKKAYSTC
STHLTVVTFYYAPFAYTYLRPRSLRSPTEDKALAVFYTILTPMLNPIIYSMRNKEVMGAL
RRLIQRISSEKM