Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2L3B Olfactory Receptor

Gene Symbol OR2L3B
Organism Dog
Family 2
Subfamily L
Pseudo No
Location chr14:1,341,100-1,342,040 (-)
Aliases cOR2L19P

Sequence information


Nucleotide sequence

ATGGAAAATTATACTCAAACATCAACTGATTTCATCCTTTTGGGCTTGTTCCCATCAACA
AGAATTGGCCTGTTCCTTTTTATTGTCATCGTTCTTGTTTTCCTAATGGCTCTGTTTGGC
AACCTGTCCATGATTCTTCTCATCTTCCTAGACACTCATCTCCACACACCCATGTATTTC
TTACTCAGTCAGCTCTCTCTCATTGACCTAAACTACATCTCCACAATTGTCCCCAAGATG
GCTTACAATTTTGTGTTTGGAAACAAGTCTATCTCCTTCATTGGGTGTGGGGCTCAGAGC
TTCTTCTTCTTGACATTAGGAGGAGCAGAAGCATTGCTCCTAATATCTATGGCCTATGAT
CGTTATGTGGCTATTTGCTTTCCTCTCCACTATTCCATTCGTATGAACAAAAAAGTGTGC
ATGTTGATGATAACAGGATCTTGGATAATGGGATCAATCAACTCCTGTGCCCACACTGCA
TATGCCTTCCATATACCTTACTGTCGATCCAGAACTATCAACCACTTCTTCTGTGATGTC
CCAGCCATGTTGACTCTGGCCTGCATGGACACCTGGGTCTATGAGTACACAGTGTTTGTC
AGTACCATCCTCTTCCTTGTGTTTCCTTTCATTTGCATTACTTTTTCCTATATCCGGGTC
CTCCTAGCTATCTGCCGCATGCAGTCTACAGAAGGGAGGAAGAAAGCTTATTCCACCTGC
AGCACCCACCTAACTGTGGTGACTTTCTACTATGTACCTTTTGCTTACACTTATTTACGC
CCAAGATCACTTAGATCTCCAACAGAGGACAAGGCCTTGGCTGTCTTCTACACCATCTTG
ACTCCAATGCTCAACCCCATCATCTACAGCCTGAGAAACAAGGAGGTGATGGGAGCCATG
AGGCGATCAATTCAGAGAGCCTGCTTTGTAAAAATG


Conceptual translation

MENYTQTSTDFILLGLFPSTRIGLFLFIVIVLVFLMALFGNLSMILLIFLDTHLHTPMYF
LLSQLSLIDLNYISTIVPKMAYNFVFGNKSISFIGCGAQSFFFLTLGGAEALLLISMAYD
RYVAICFPLHYSIRMNKKVCMLMITGSWIMGSINSCAHTAYAFHIPYCRSRTINHFFCDV
PAMLTLACMDTWVYEYTVFVSTILFLVFPFICITFSYIRVLLAICRMQSTEGRKKAYSTC
STHLTVVTFYYVPFAYTYLRPRSLRSPTEDKALAVFYTILTPMLNPIIYSLRNKEVMGAM
RRSIQRACFVKM