Search Olfactory receptors

(e.g. OR1G1, AF087928, Segregating Pseudo)

Select ORs from

Family: Subfamily:

Chromosome:

Back to all Dog symbols

Dog OR2L5 Olfactory Receptor

Gene Symbol OR2L5
Organism Dog
Family 2
Subfamily L
Pseudo No
Location chr14:2051218-2052162 (+)
Aliases cOR2L20, cOR2L20

Sequence information


Nucleotide sequence

ATGAAAATTATGGAAAATTACAACCAAACATTAACAGATTTCCTTTTATTGGGGTTGTTT
CCATCATCAAGAATTGGCCTCTTTCTTTTCATTCTCATAGTATTTATTTTCTTAATGGCT
CTTTTTGGCAACCTGTCCATGATCATCCTCATCATCGTGGACACTCATCTCCACACACCC
ATGTATTTTCTACTTAGCCAGCTCTCCCTCATGGACCTAAACTACATCTCCACCATTGTC
CCAAAGATGGTTTCTGATTATCTCTTTGGAAACAAGTCCATCTCACTTATTGGTTGTGAA
GTTCAGAGCTTCTTCTTCTTGACTTTAGCAGTTGCAGAAGCACTACTCTTGACATCTATG
GCTTATGATCGTTACGTGGCTATTTGCTTTCCTCTTCACTATCCCATTCGCATGAGCAAA
AAATTGTGTGTGCTGATGATAACAGGATCTTGGACAATTGGCTCTATCAACTCCTGTGCT
CACACTGCATATGCCTTCCATATACCTTACTGTCGATCCAGAACTATCAACCATTTCTTC
TGTGATGTCCCAGCCATGTTGACGTTGGCCTGCATGGACACCTGGGTCTATGAGTACACA
GTGTTTGTAAGCACCACACTCTTGATTGTGTTTCCTTTCATTGGCATTGCATGCTCCTAT
GGCCAGGTCCTCCTTGCCATCTGCCGCATGCAATCAACAGAAGGGAGGAAGAAAGCTTAT
TCCACCTGCAGCACTCACCTCACTGTGGTGACTTTCTACTATGCACCCTTTGCTTACACT
TATCTACGCCCAAGATCCCTCCGAACCCCAACAGAGGACAAGGCTCTAGCTGTTCTCTAC
ACCATTCTGACCCCAATGCTCAACCCCATCATCTACAGCCTGAGAAACAAGGAGGTGATA
GGGGCCCTGAGACGATTGATTCAGAAGATCAGCTTTGTAAAAATG


Conceptual translation

MKIMENYNQTLTDFLLLGLFPSSRIGLFLFILIVFIFLMALFGNLSMIILIIVDTHLHTP
MYFLLSQLSLMDLNYISTIVPKMVSDYLFGNKSISLIGCEVQSFFFLTLAVAEALLLTSM
AYDRYVAICFPLHYPIRMSKKLCVLMITGSWTIGSINSCAHTAYAFHIPYCRSRTINHFF
CDVPAMLTLACMDTWVYEYTVFVSTTLLIVFPFIGIACSYGQVLLAICRMQSTEGRKKAY
STCSTHLTVVTFYYAPFAYTYLRPRSLRTPTEDKALAVLYTILTPMLNPIIYSLRNKEVI
GALRRLIQKISFVKM